PDB entry 2fb7

View 2fb7 on RCSB PDB site
Description: NMR Solution Structure of protein from Zebra Fish Dr.13312
Class: structural genomics, unknown function
Keywords: Dr.13312, BC055387, AAH55387, LSm14_N, RAP55, Sm-like protein, strongly bent five-stranded antiparallel beta-sheet, Structural Genomics, PSI, Protein Structure Initiative, Center for Eukaryotic Structural Genomics, CESG, UNKNOWN FUNCTION
Deposited on 2005-12-08, released 2005-12-27
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Sm-like protein, LSm-14_N (RAP55)
    Species: Danio rerio [TaxId:7955]
    Gene: BC055387
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2fb7a1

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2fb7A (A:)
    ghhhhhhledpsggtpyigskisliskaeiryegilytidtenstvalakvrsfgtedrp
    tdrpiaprdetfeyiifrgsdikdltvceppkpim
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fb7A (A:)
    pyigskisliskaeiryegilytidtenstvalakvrsfgtedrptdrpiaprdetfeyi
    ifrgsdikdltvceppkpim