PDB entry 2fb7
View 2fb7 on RCSB PDB site
Description: NMR Solution Structure of protein from Zebra Fish Dr.13312
Class: structural genomics, unknown function
Keywords: Dr.13312, BC055387, AAH55387, LSm14_N, RAP55, Sm-like protein, strongly bent five-stranded antiparallel beta-sheet, Structural Genomics, PSI, Protein Structure Initiative, Center for Eukaryotic Structural Genomics, CESG, UNKNOWN FUNCTION
Deposited on
2005-12-08, released
2005-12-27
The last revision prior to the SCOPe 2.04 freeze date was dated
2009-02-24, with a file datestamp of
2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Sm-like protein, LSm-14_N (RAP55)
Species: Danio rerio [TaxId:7955]
Gene: BC055387
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.04: d2fb7a1
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>2fb7A (A:)
ghhhhhhledpsggtpyigskisliskaeiryegilytidtenstvalakvrsfgtedrp
tdrpiaprdetfeyiifrgsdikdltvceppkpim
Sequence, based on observed residues (ATOM records): (download)
>2fb7A (A:)
pyigskisliskaeiryegilytidtenstvalakvrsfgtedrptdrpiaprdetfeyi
ifrgsdikdltvceppkpim