PDB entry 2fb4

View 2fb4 on RCSB PDB site
Description: dir primaerstruktur des kristallisierbaren monoklonalen immunoglobulins igg1 kol. ii. aminosaeuresequenz der l-kette, lambda-typ, subgruppe i (german)
Deposited on 1989-04-18, released 1989-07-12
The last revision prior to the SCOP 1.71 freeze date was dated 1989-07-12, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 1.9 Å
R-factor: 0.189
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2fb4H (H:)
    evqlvqsgggvvqpgrslrlscsssgfifssyamywvrqapgkglewvaiiwddgsdqhy
    adsvkgrftisrndskntlflqmdslrpedtgvyfcardgghgfcssascfgpdywgqgt
    pvtvssastkgpsvfplapsskstsggtaalgclvkdyfpqpvtvswnsgaltsgvhtfp
    avlqssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkrvepksc
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2fb4L (L:)
    qsvltqppsasgtpgqrvtiscsgtssnigsstvnwyqqlpgmapklliyrdamrpsgvp
    drfsgsksgasaslaigglqsedetdyycaawdvslnayvfgtgtkvtvlgqpkanptvt
    lfppsseelqankatlvclisdfypgavtvawkadgspvkagvettkpskqsnnkyaass
    ylsltpeqwkshrsyscqvthegstvektvaptecs