PDB entry 2fb4

View 2fb4 on RCSB PDB site
Description: dir primaerstruktur des kristallisierbaren monoklonalen immunoglobulins igg1 kol. II. aminosaeuresequenz der l-kette, lambda-typ, subgruppe I (german)
Class: immunoglobulin
Keywords: immunoglobulin
Deposited on 1989-04-18, released 1989-07-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.189
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: igg1-lambda kol fab (heavy chain)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01772 (1-228)
      • conflict (5)
      • conflict (22-23)
      • conflict (27)
      • conflict (30)
      • conflict (32)
      • conflict (34)
      • conflict (49)
      • conflict (52)
      • conflict (56-58)
      • conflict (72-73)
      • conflict (79-80)
      • conflict (83)
      • conflict (87)
      • conflict (91)
      • conflict (94)
      • conflict (98)
      • conflict (100)
      • conflict (100)
      • conflict (100)
      • conflict (100)
      • conflict (105-107)
      • conflict (107)
      • conflict (107)
      • conflict (107)
      • conflict (112)
      • conflict (120)
      • conflict (160)
    Domains in SCOPe 2.07: d2fb4h1, d2fb4h2
  • Chain 'L':
    Compound: igg1-lambda kol fab (light chain)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2FB4 (0-215)
    Domains in SCOPe 2.07: d2fb4l1, d2fb4l2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2fb4H (H:)
    evqlvqsgggvvqpgrslrlscsssgfifssyamywvrqapgkglewvaiiwddgsdqhy
    adsvkgrftisrndskntlflqmdslrpedtgvyfcardgghgfcssascfgpdywgqgt
    pvtvssastkgpsvfplapsskstsggtaalgclvkdyfpqpvtvswnsgaltsgvhtfp
    avlqssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkrvepksc
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2fb4L (L:)
    qsvltqppsasgtpgqrvtiscsgtssnigsstvnwyqqlpgmapklliyrdamrpsgvp
    drfsgsksgasaslaigglqsedetdyycaawdvslnayvfgtgtkvtvlgqpkanptvt
    lfppsseelqankatlvclisdfypgavtvawkadgspvkagvettkpskqsnnkyaass
    ylsltpeqwkshrsyscqvthegstvektvaptecs