PDB entry 2fb3

View 2fb3 on RCSB PDB site
Description: Structure of MoaA in complex with 5'-GTP
Class: Ligand Binding Protein
Keywords: S-adenosylmethionine, TIM barrel, [4Fe-4S] clusters, 5'-GTP, 5'-deoxyadenosine, Ligand Binding Protein
Deposited on 2005-12-08, released 2006-05-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.229
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Molybdenum cofactor biosynthesis protein A
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: MoaA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2fb3a_
  • Chain 'B':
    Compound: Molybdenum cofactor biosynthesis protein A
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: MoaA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2fb3b_
  • Heterogens: SO4, MET, SF4, GTP, 5AD, POP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2fb3A (A:)
    mveqikdklgrpirdlrlsvtdrcnfrcdycmpkevfgddfvflpknelltfdemariak
    vyaelgvkkiritggeplmrrdldvliaklnqidgiediglttnglllkkhgqklydagl
    rrinvsldaiddtlfqsinnrnikattileqidyatsiglnvkvnvviqkginddqiipm
    leyfkdkhieirfiefmdvgndngwdfskvvtkdemltmieqhfeidpvepkyfgevaky
    yrhkdngvqfglitsvsqsfcstctrarlssdgkfygclfatvdgfnvkafirsgvtdee
    lkeqfkalwqirddrysdertaqtvanrqrkkinmnyigg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fb3A (A:)
    eqikdklgrpirdlrlsvtdrcnfrcdycmpkevfgddfvflpknelltfdemariakvy
    aelgvkkiritggeplmrrdldvliaklnqidgiediglttnglllkkhgqklydaglrr
    invsldaiddtlfqsinnrnikattileqidyatsiglnvkvnvviqkginddqiipmle
    yfkdkhieirfiefmdvgndngwdfskvvtkdemltmieqhfeidpvepkyfgevakyyr
    hkdngvqfglitsvsqsfcstctrarlssdgkfygclfatvdgfnvkafirsgvtdeelk
    eqfkalwqirddrysdertaqtvanrq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2fb3B (B:)
    mveqikdklgrpirdlrlsvtdrcnfrcdycmpkevfgddfvflpknelltfdemariak
    vyaelgvkkiritggeplmrrdldvliaklnqidgiediglttnglllkkhgqklydagl
    rrinvsldaiddtlfqsinnrnikattileqidyatsiglnvkvnvviqkginddqiipm
    leyfkdkhieirfiefmdvgndngwdfskvvtkdemltmieqhfeidpvepkyfgevaky
    yrhkdngvqfglitsvsqsfcstctrarlssdgkfygclfatvdgfnvkafirsgvtdee
    lkeqfkalwqirddrysdertaqtvanrqrkkinmnyigg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fb3B (B:)
    qikdklgrpirdlrlsvtdrcnfrcdycmpkevfgddfvflpknelltfdemariakvya
    elgvkkiritggeplmrrdldvliaklnqidgiediglttnglllkkhgqklydaglrri
    nvsldaiddtlfqsinnrnikattileqidyatsiglnvkvnvviqkginddqiipmley
    fkdkhieirfiefmdvgndngwdfskvvtkdemltmieqhfeidpvepkyfgevakyyrh
    kdngvqfglitsvsqsfcstctrarlssdgkfygclfatvdgfnvkafirsgvtdeelke
    qfkalwqirddrysdertaqtvanrq