PDB entry 2fb2

View 2fb2 on RCSB PDB site
Description: Structure of the MoaA Arg17/266/268/Ala triple mutant
Class: Ligand Binding Protein
Keywords: S-adenosylmethionine, TIM barrel, [4Fe-4S] clusters, Ligand Binding Protein
Deposited on 2005-12-08, released 2006-05-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.196
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Molybdenum cofactor biosynthesis protein A
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: MoaA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P69848
      • engineered (16)
      • engineered (265)
      • engineered (267)
    Domains in SCOPe 2.08: d2fb2a_
  • Chain 'B':
    Compound: Molybdenum cofactor biosynthesis protein A
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: MoaA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P69848
      • engineered (16)
      • engineered (265)
      • engineered (267)
    Domains in SCOPe 2.08: d2fb2b_
  • Heterogens: SO4, SAM, SF4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2fb2A (A:)
    mveqikdklgrpirdlalsvtdrcnfrcdycmpkevfgddfvflpknelltfdemariak
    vyaelgvkkiritggeplmrrdldvliaklnqidgiediglttnglllkkhgqklydagl
    rrinvsldaiddtlfqsinnrnikattileqidyatsiglnvkvnvviqkginddqiipm
    leyfkdkhieirfiefmdvgndngwdfskvvtkdemltmieqhfeidpvepkyfgevaky
    yrhkdngvqfglitsvsqsfcstctaaalssdgkfygclfatvdgfnvkafirsgvtdee
    lkeqfkalwqirddrysdertaqtvanrqrkkinmnyigg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fb2A (A:)
    eqikdklgrpirdlalsvtdrcnfrcdycmpkevfgddfvflpknelltfdemariakvy
    aelgvkkiritggeplmrrdldvliaklnqidgiediglttnglllkkhgqklydaglrr
    invsldaiddtlfqsinnrnikattileqidyatsiglnvkvnvviqkginddqiipmle
    yfkdkhieirfiefmdvgndngwdfskvvtkdemltmieqhfeidpvepkyfgevakyyr
    hkdngvqfglitsvsqsfcstctaaalssdgkfygclfatvdgfnvkafirsgvtdeelk
    eqfkalwqirddrysdertaqtvanrq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2fb2B (B:)
    mveqikdklgrpirdlalsvtdrcnfrcdycmpkevfgddfvflpknelltfdemariak
    vyaelgvkkiritggeplmrrdldvliaklnqidgiediglttnglllkkhgqklydagl
    rrinvsldaiddtlfqsinnrnikattileqidyatsiglnvkvnvviqkginddqiipm
    leyfkdkhieirfiefmdvgndngwdfskvvtkdemltmieqhfeidpvepkyfgevaky
    yrhkdngvqfglitsvsqsfcstctaaalssdgkfygclfatvdgfnvkafirsgvtdee
    lkeqfkalwqirddrysdertaqtvanrqrkkinmnyigg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fb2B (B:)
    qikdklgrpirdlalsvtdrcnfrcdycmpkevfgddfvflpknelltfdemariakvya
    elgvkkiritggeplmrrdldvliaklnqidgiediglttnglllkkhgqklydaglrri
    nvsldaiddtlfqsinnrnikattileqidyatsiglnvkvnvviqkginddqiipmley
    fkdkhieirfiefmdvgndngwdfskvvtkdemltmieqhfeidpvepkyfgevakyyrh
    kdngvqfglitsvsqsfcstctaaalssdgkfygclfatvdgfnvkafirsgvtdeelke
    qfkalwqirddrysdertaqtvanrq