PDB entry 2fax

View 2fax on RCSB PDB site
Description: clostridium beijerinckii flavodoxin mutant: n137a oxidized (150k)
Class: electron transport
Keywords: electron transport, flavoprotein, fmn
Deposited on 1996-12-24, released 1997-03-12
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.175
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: flavodoxin
    Species: Clostridium beijerinckii [TaxId:1520]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00322 (0-137)
      • engineered (136)
    Domains in SCOPe 2.05: d2faxa_
  • Heterogens: FMN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2faxA (A:)
    mkivywsgtgntekmaeliakgiiesgkdvntinvsdvnidellnedililgcsamgdev
    leesefepfieeistkisgkkvalfgsygwgdgkwmrdfeermngygcvvvetplivqne
    pdeaeqdciefgkkiaai