PDB entry 2fat

View 2fat on RCSB PDB site
Description: An anti-urokinase plasminogen activator receptor (UPAR) antibody: Crystal structure and binding epitope
Class: immune system
Keywords: anti-upar antibody, atn-615, fab, crystal structure, immune system
Deposited on 2005-12-07, released 2006-11-14
The last revision prior to the SCOP 1.75 freeze date was dated 2008-08-12, with a file datestamp of 2008-08-08.
Experiment type: XRAY
Resolution: 1.77 Å
R-factor: 0.239
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: FAB ATN-615, heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2FAT (0-213)
    Domains in SCOP 1.75: d2fath1, d2fath2
  • Chain 'L':
    Compound: FAB ATN-615, light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2FAT (0-211)
    Domains in SCOP 1.75: d2fatl1, d2fatl2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2fatH (H:)
    gvklqqsgpevvkpgasvkisckasgysftnfyihwvkqrpgqglewigwifhgsdntey
    nekfkdkatltadtssstaymqlssltsedsavyfcarwgphwyfdvwgqgttvtvssak
    ttppsvyplapgnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytlsss
    vtvpsstwpsetvtcnvahpasstkvdkkiaaag
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2fatL (L:)
    divltqspditaaslgqkvtitcsasssvsymhwyqqksgtspkpwifeisklasgvpar
    fsgsgsgtsysltissmeaedaaiyycqqwnypftfgggtkleikradaaptvsifppss
    eqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstltlt
    kdeyerhnsytceathktstspivksfnrnec