PDB entry 2fap

View 2fap on RCSB PDB site
Description: the structure of the immunophilin-immunosuppressant fkbp12-(c16)-ethoxy rapamycin complex interacting with huma
Deposited on 1998-09-22, released 1999-05-18
The last revision prior to the SCOP 1.71 freeze date was dated 1999-08-09, with a file datestamp of 1999-08-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.196
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d2fapa_
  • Chain 'B':
    Domains in SCOP 1.71: d2fapb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2fapA (A:)
gvqvetispgdgrtfpkrgqtcvvhytgmledgkkfdssrdrnkpfkfmlgkqevirgwe
egvaqmsvgqrakltispdyaygatghpgiipphatlvfdvellkle

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2fapB (B:)
vailwhemwhegleeasrlyfgernvkgmfevleplhammergpqtlketsfnqaygrdl
meaqewcrkymksgnvkdltqawdlyyhvfrris