PDB entry 2fal

View 2fal on RCSB PDB site
Description: x-ray crystal structure of ferric aplysia limacina myoglobin in different liganded states
Class: oxygen storage
Keywords: oxygen storage
Deposited on 1993-06-14, released 1993-10-31
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.151
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myoglobin
    Species: Aplysia limacina [TaxId:6502]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02210 (0-144)
      • conflict (21)
      • conflict (25-26)
      • conflict (79)
    Domains in SCOPe 2.06: d2fala_
  • Heterogens: CYN, HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2falA (A:)
    slsaaeadlagkswapvfanknangldflvalfekfpdsanffadfkgksvadikaspkl
    rdvssriftrlnefvnnaanagkmsamlsqfakehvgfgvgsaqfenvrsmfpgfvasva
    appagadaawtklfgliidalkaaga