PDB entry 2fal

View 2fal on RCSB PDB site
Description: x-ray crystal structure of ferric aplysia limacina myoglobin in different liganded states
Class: oxygen storage
Keywords: oxygen storage
Deposited on 1993-06-14, released 1993-10-31
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.151
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Myoglobin
  Species: Aplysia limacina [TaxId:6502]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02210 (0-144)
    • conflict (21)
    • conflict (25-26)
    • conflict (79)
  Domains in SCOPe 2.01: d2fala_
• Heterogens: CYN, HEM, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2falA (A:)
  slsaaeadlagkswapvfanknangldflvalfekfpdsanffadfkgksvadikaspkl
  rdvssriftrlnefvnnaanagkmsamlsqfakehvgfgvgsaqfenvrsmfpgfvasva
  appagadaawtklfgliidalkaaga