PDB entry 2fai

View 2fai on RCSB PDB site
Description: Human Estrogen Receptor Alpha Ligand-Binding Domain In Complex With OBCP-2M and A Glucocorticoid Receptor Interacting Protein 1 NR Box II Peptide
Class: hormone/growth factor receptor
Keywords: Estrogen Receptor, LBD, GRIP peptide, HORMONE-GROWTH FACTOR RECEPTOR COMPLEX
Deposited on 2005-12-07, released 2006-05-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.202
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Estrogen receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: ESR1, ESR, NR3A1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03372
      • modified residue (83)
      • modified residue (119)
      • modified residue (232)
      • engineered (239)
    Domains in SCOPe 2.07: d2faia_
  • Chain 'B':
    Compound: Estrogen receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: ESR1, ESR, NR3A1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03372
      • modified residue (83)
      • modified residue (119)
      • modified residue (232)
      • engineered (239)
    Domains in SCOPe 2.07: d2faib_
  • Chain 'C':
    Compound: nuclear receptor coactivator 2
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: nuclear receptor coactivator 2
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Heterogens: 459, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2faiA (A:)
    ikrskknslalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhm
    inwakrvpgfvdltlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkc
    vegmveifdmllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihr
    vldkitdtlihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvvpls
    dlllemldahrlhapts
    

    Sequence, based on observed residues (ATOM records): (download)
    >2faiA (A:)
    slalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhminwakrv
    pgfvdltlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkcvegmvei
    fdmllatssrfrmmnlqgeefvclksiillnsgvytfeekdhihrvldkitdtlihlmak
    agltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvvplsdlllemldahr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2faiB (B:)
    ikrskknslalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhm
    inwakrvpgfvdltlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkc
    vegmveifdmllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihr
    vldkitdtlihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvvpls
    dlllemldahrlhapts
    

    Sequence, based on observed residues (ATOM records): (download)
    >2faiB (B:)
    nslalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhminwakr
    vpgfvdltlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkcvegmve
    ifdmllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihrvldkit
    dtlihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvvplsdlllem
    ldahr
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.