PDB entry 2fah

View 2fah on RCSB PDB site
Description: The structure of mitochondrial PEPCK, Complex with Mn and GDP
Class: lyase
Keywords: phosphoenolpyruvate carboxykinase, PEPCK, PCK, PEP,GDP, kinase, phosphoryl transfer, LYASE
Deposited on 2005-12-07, released 2006-06-27
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-04-29, with a file datestamp of 2015-04-24.
Experiment type: XRAY
Resolution: 2.09 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphoenolpyruvate carboxykinase
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21642 (0-607)
      • insertion (95)
      • see remark 999 (97)
      • see remark 999 (199)
      • see remark 999 (234)
      • see remark 999 (305)
      • see remark 999 (468)
    Domains in SCOPe 2.06: d2faha1, d2faha2
  • Chain 'B':
    Compound: phosphoenolpyruvate carboxykinase
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21642 (0-607)
      • insertion (95)
      • see remark 999 (97)
      • see remark 999 (199)
      • see remark 999 (234)
      • see remark 999 (305)
      • see remark 999 (468)
    Domains in SCOPe 2.06: d2fahb1, d2fahb2
  • Chain 'C':
    Compound: phosphoenolpyruvate carboxykinase
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21642 (0-607)
      • insertion (95)
      • see remark 999 (97)
      • see remark 999 (199)
      • see remark 999 (234)
      • see remark 999 (305)
      • see remark 999 (468)
    Domains in SCOPe 2.06: d2fahc1, d2fahc2
  • Chain 'D':
    Compound: phosphoenolpyruvate carboxykinase
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21642 (0-607)
      • insertion (95)
      • see remark 999 (97)
      • see remark 999 (199)
      • see remark 999 (234)
      • see remark 999 (305)
      • see remark 999 (468)
    Domains in SCOPe 2.06: d2fahd1, d2fahd2
  • Heterogens: MN, GDP, MLA, 20S, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2fahA (A:)
    lstslsalpaaardfveeavrlcrprevllcdgseeegkellrglqddgvlhplpkydnc
    wlartdprdvarvesktvlvtpeqsdavpppppsggppqlgnwmspnafqaavqerfpgc
    magrplyvipfsmgpptsplaklgvqvtdspyvvlsmrimtrvgpavlqrldddfvrclh
    svgrplplteplvsswpcdpsrvlvahipserrivsfgsgyggnsllgkkcfalriasrm
    aqqqgwlaehmlilgvtspsgekrymaaafpsacgktnlammtpslpgwrihcvgddiaw
    mkfddegrlrainpergffgvapgtssrtnpnamatiarntiftnvglrsdggvywdgld
    eptepgvtytswlgkpwkhgdpepcahpnsrfcapadqcpimdprwddpegvpidaiifg
    grrprgvplvveafgwrhgvfmgsamrseataaaehkggrlmhdpfamrpffgynagryl
    ehwlstglrsnarlprlfhvnwflrdnegrfvwpgfghnarvlawifgriqgrdtarptp
    igwvpkegdldlgglpgvdysqlfpmekgfweeecrqlreyygenfgadlprdvmaeleg
    leervrkm
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2fahB (B:)
    lstslsalpaaardfveeavrlcrprevllcdgseeegkellrglqddgvlhplpkydnc
    wlartdprdvarvesktvlvtpeqsdavpppppsggppqlgnwmspnafqaavqerfpgc
    magrplyvipfsmgpptsplaklgvqvtdspyvvlsmrimtrvgpavlqrldddfvrclh
    svgrplplteplvsswpcdpsrvlvahipserrivsfgsgyggnsllgkkcfalriasrm
    aqqqgwlaehmlilgvtspsgekrymaaafpsacgktnlammtpslpgwrihcvgddiaw
    mkfddegrlrainpergffgvapgtssrtnpnamatiarntiftnvglrsdggvywdgld
    eptepgvtytswlgkpwkhgdpepcahpnsrfcapadqcpimdprwddpegvpidaiifg
    grrprgvplvveafgwrhgvfmgsamrseataaaehkggrlmhdpfamrpffgynagryl
    ehwlstglrsnarlprlfhvnwflrdnegrfvwpgfghnarvlawifgriqgrdtarptp
    igwvpkegdldlgglpgvdysqlfpmekgfweeecrqlreyygenfgadlprdvmaeleg
    leervrkm
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2fahC (C:)
    lstslsalpaaardfveeavrlcrprevllcdgseeegkellrglqddgvlhplpkydnc
    wlartdprdvarvesktvlvtpeqsdavpppppsggppqlgnwmspnafqaavqerfpgc
    magrplyvipfsmgpptsplaklgvqvtdspyvvlsmrimtrvgpavlqrldddfvrclh
    svgrplplteplvsswpcdpsrvlvahipserrivsfgsgyggnsllgkkcfalriasrm
    aqqqgwlaehmlilgvtspsgekrymaaafpsacgktnlammtpslpgwrihcvgddiaw
    mkfddegrlrainpergffgvapgtssrtnpnamatiarntiftnvglrsdggvywdgld
    eptepgvtytswlgkpwkhgdpepcahpnsrfcapadqcpimdprwddpegvpidaiifg
    grrprgvplvveafgwrhgvfmgsamrseataaaehkggrlmhdpfamrpffgynagryl
    ehwlstglrsnarlprlfhvnwflrdnegrfvwpgfghnarvlawifgriqgrdtarptp
    igwvpkegdldlgglpgvdysqlfpmekgfweeecrqlreyygenfgadlprdvmaeleg
    leervrkm
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2fahD (D:)
    lstslsalpaaardfveeavrlcrprevllcdgseeegkellrglqddgvlhplpkydnc
    wlartdprdvarvesktvlvtpeqsdavpppppsggppqlgnwmspnafqaavqerfpgc
    magrplyvipfsmgpptsplaklgvqvtdspyvvlsmrimtrvgpavlqrldddfvrclh
    svgrplplteplvsswpcdpsrvlvahipserrivsfgsgyggnsllgkkcfalriasrm
    aqqqgwlaehmlilgvtspsgekrymaaafpsacgktnlammtpslpgwrihcvgddiaw
    mkfddegrlrainpergffgvapgtssrtnpnamatiarntiftnvglrsdggvywdgld
    eptepgvtytswlgkpwkhgdpepcahpnsrfcapadqcpimdprwddpegvpidaiifg
    grrprgvplvveafgwrhgvfmgsamrseataaaehkggrlmhdpfamrpffgynagryl
    ehwlstglrsnarlprlfhvnwflrdnegrfvwpgfghnarvlawifgriqgrdtarptp
    igwvpkegdldlgglpgvdysqlfpmekgfweeecrqlreyygenfgadlprdvmaeleg
    leervrkm