PDB entry 2fae

View 2fae on RCSB PDB site
Description: Crystal structure of E. coli decanoyl-ACP
Class: biosynthetic protein
Keywords: acyl carrier protein, acyl chain binding, fatty acid biosynthesis
Deposited on 2005-12-07, released 2006-09-26
The last revision prior to the SCOP 1.75 freeze date was dated 2006-12-19, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: 0.214
AEROSPACI score: 0.71 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Acyl carrier protein
  Species: Escherichia coli
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0A6A8 (0-76)
  Domains in SCOP 1.75: d2faea1
• Chain 'B':
  Compound: Acyl carrier protein
  Species: Escherichia coli
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0A6A8 (0-76)
  Domains in SCOP 1.75: d2faeb1
• Heterogens: ZN, PM8, PSE, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2faeA (A:)
  stieervkkiigeqlgvkqeevtnnasfvedlgadsldtvelvmaleeefdteipdeeae
  kittvqaaidyinghqa
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2faeB (B:)
  stieervkkiigeqlgvkqeevtnnasfvedlgadsldtvelvmaleeefdteipdeeae
  kittvqaaidyinghqa