PDB entry 2fae

View 2fae on RCSB PDB site
Description: Crystal structure of E. coli decanoyl-ACP
Class: biosynthetic protein
Keywords: acyl carrier protein, acyl chain binding, fatty acid biosynthesis
Deposited on 2005-12-07, released 2006-09-26
The last revision prior to the SCOP 1.73 freeze date was dated 2006-12-19, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: 0.214
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Acyl carrier protein
    Species: Escherichia coli
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2faea1
  • Chain 'B':
    Compound: Acyl carrier protein
    Species: Escherichia coli
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2faeb1
  • Heterogens: ZN, PM8, PSE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2faeA (A:)
    stieervkkiigeqlgvkqeevtnnasfvedlgadsldtvelvmaleeefdteipdeeae
    kittvqaaidyinghqa
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2faeB (B:)
    stieervkkiigeqlgvkqeevtnnasfvedlgadsldtvelvmaleeefdteipdeeae
    kittvqaaidyinghqa