PDB entry 2fad

View 2fad on RCSB PDB site
Description: Crystal structure of E. coli heptanoyl-ACP
Class: biosynthetic protein
Keywords: acyl carrier protein, acyl chain binding, fatty acid biosynthesis, BIOSYNTHETIC PROTEIN
Deposited on 2005-12-07, released 2006-09-26
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.209
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Acyl carrier protein
    Species: Escherichia coli [TaxId:562]
    Gene: acpP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2fada_
  • Chain 'B':
    Compound: Acyl carrier protein
    Species: Escherichia coli [TaxId:562]
    Gene: acpP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2fadb_
  • Heterogens: NA, ZN, PM5, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2fadA (A:)
    stieervkkiigeqlgvkqeevtnnasfvedlgadsldtvelvmaleeefdteipdeeae
    kittvqaaidyinghqa
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2fadB (B:)
    stieervkkiigeqlgvkqeevtnnasfvedlgadsldtvelvmaleeefdteipdeeae
    kittvqaaidyinghqa