PDB entry 2fad

View 2fad on RCSB PDB site
Description: Crystal structure of E. coli heptanoyl-ACP
Class: biosynthetic protein
Keywords: acyl carrier protein, acyl chain binding, fatty acid biosynthesis, BIOSYNTHETIC PROTEIN
Deposited on 2005-12-07, released 2006-09-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.209
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Acyl carrier protein
  Species: Escherichia coli [TaxId:562]
  Gene: acpP
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0A6A8 (0-76)
  Domains in SCOPe 2.08: d2fada_
• Chain 'B':
  Compound: Acyl carrier protein
  Species: Escherichia coli [TaxId:562]
  Gene: acpP
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0A6A8 (0-76)
  Domains in SCOPe 2.08: d2fadb_
• Heterogens: NA, ZN, PM5, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2fadA (A:)
  stieervkkiigeqlgvkqeevtnnasfvedlgadsldtvelvmaleeefdteipdeeae
  kittvqaaidyinghqa
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2fadB (B:)
  stieervkkiigeqlgvkqeevtnnasfvedlgadsldtvelvmaleeefdteipdeeae
  kittvqaaidyinghqa