PDB entry 2f9y

View 2f9y on RCSB PDB site
Description: The Crystal Structure of The Carboxyltransferase Subunit of ACC from Escherichia coli
Class: ligase
Keywords: zinc ribbon, crotonase superfamily, spiral domain, LIGASE
Deposited on 2005-12-06, released 2006-12-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: N/A
AEROSPACI score: 0.1 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Acetyl-CoA carboxylase, Carboxyltransferase alpha chain
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • GB BAA77860 (Start-338)
    Domains in SCOPe 2.07: d2f9ya1
  • Chain 'B':
    Compound: acetyl-coenzyme A carboxylase carboxyl transferase subunit beta
    Species: Escherichia coli [TaxId:562]
    Gene: accD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2f9yb1
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2f9yA (A:)
    mgsshhhhhhssglvprgshmslnfldfeqpiaeleakidsltagsrqdekldinideev
    hrlreksveltrkifadlgawqiaqlarhpqrpytldyvrlafdefdelagdrayaddka
    ivggiarldgrpvmiighqkgretkekirrnfgmpapegyrkalrlmqmaerfkmpiitf
    idtpgaypgvgaeergqseaiarnlremsrlgvpvvctvigeggsggalaigvgdkvnml
    qystysvispegcasilwksadkaplaaeamgiirprlkelklidsiipeplggahrnpe
    amaaslkaqlladladldvlstedlknrryqrlmsygya
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f9yA (A:)
    nfldfeqpiaeleakidsdeevhrlreksveltrkifadlgawqiaqlarhpqrpytldy
    vrlafdefdelagdrayaddkaivggiarldgrpvmiighqkgretkekirrnfgmpape
    gyrkalrlmqmaerfkmpiitfidtpgaypgvgaeergqseaiarnlremsrlgvpvvct
    vigeggsggalaigvgdkvnmlqystysvispegcasilwksadkaplaaeamgiirprl
    kelklidsiipeplggahrnpeamaaslkaqlladladldvlstedlknrryqrlmsygy
    a
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2f9yB (B:)
    mswieriksnitptrkasipegvwtkcdscgqvlyraelernlevcpkcdhhmrmtarnr
    lhslldegslvelgselepkdvlkfrdskkykdrlasaqketgekdalvvmkgtlygmpv
    vaaafefafmggsmgsvvgarfvraveqaledncplicfsasggarmqealmslmqmakt
    saalakmqerglpyisvltdptmggvsasfamlgdlniaepkaligfagprvieqtvrek
    lppgfqrsefliekgaidmivrrpemrlklasilaklmnlpapnpeapregvvvppvpdq
    epea
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f9yB (B:)
    vwtkcdscgqvlyraelernlevcpkcdhhmrmtarnrlhslldegslvelgselepkdv
    lkfrdskkykqketgekdalvvmkgtlygmpvvaaafefafmggsmgsvvgarfvraveq
    aledncplicfsasggarmqealmslmqmaktsaalakmqerglpyisvltdptmggvsa
    sfamlgdlniaepkaligfagprvieqtvreklppgfqrsefliekgaidmivrrpemrl
    klasilaklmnlpapnp