PDB entry 2f9o

View 2f9o on RCSB PDB site
Description: Crystal Structure of the Recombinant Human Alpha I Tryptase Mutant D216G
Class: hydrolase
Keywords: serine proteinase, trypsin-like, difucosylation, HYDROLASE
Deposited on 2005-12-06, released 2006-01-31
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.216
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tryptase alpha-1
    Species: Homo sapiens [TaxId:9606]
    Gene: TPSAB1, TPS1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15157 (0-End)
      • engineered (45)
      • engineered (214)
    Domains in SCOPe 2.01: d2f9oa_
  • Chain 'B':
    Compound: Tryptase alpha-1
    Species: Homo sapiens [TaxId:9606]
    Gene: TPSAB1, TPS1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15157 (0-End)
      • engineered (45)
      • engineered (214)
    Domains in SCOPe 2.01: d2f9ob_
  • Chain 'C':
    Compound: Tryptase alpha-1
    Species: Homo sapiens [TaxId:9606]
    Gene: TPSAB1, TPS1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15157 (0-End)
      • engineered (45)
      • engineered (214)
    Domains in SCOPe 2.01: d2f9oc_
  • Chain 'D':
    Compound: Tryptase alpha-1
    Species: Homo sapiens [TaxId:9606]
    Gene: TPSAB1, TPS1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15157 (0-End)
      • engineered (45)
      • engineered (214)
    Domains in SCOPe 2.01: d2f9od_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2f9oA (A:)
    ivggqeaprskwpwqvslrvrdrywmhfcggslihpqwvltaahcvgpdvkdlatlrvql
    reqhlyyqdqllpvsriivhpqfyiiqtgadialleleepvnissrvhtvmlppasetfp
    pgmpcwvtgwgdvdndeplpppfplkqvkvpimenhicdakyhlgaytgddvriirddml
    cagnsqrdsckgdsggplvckvngtwlqagvvswgegcaqpnrpgiytrvtyyldwihhy
    vpkkp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f9oA (A:)
    ivggqeaprskwpwqvslrvrdrywmhfcggslihpqwvltaahcvgpdvkdlatlrvql
    reqhlyyqdqllpvsriivhpqfyiiqtgadialleleepvnissrvhtvmlppasetfp
    pgmpcwvtgwgdvdndeplpppfplkqvkvpimenhicdakyhlgaytgddvriirddml
    cagnsqrdsckgdsggplvckvngtwlqagvvswgegcaqpnrpgiytrvtyyldwihhy
    vp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2f9oB (B:)
    ivggqeaprskwpwqvslrvrdrywmhfcggslihpqwvltaahcvgpdvkdlatlrvql
    reqhlyyqdqllpvsriivhpqfyiiqtgadialleleepvnissrvhtvmlppasetfp
    pgmpcwvtgwgdvdndeplpppfplkqvkvpimenhicdakyhlgaytgddvriirddml
    cagnsqrdsckgdsggplvckvngtwlqagvvswgegcaqpnrpgiytrvtyyldwihhy
    vpkkp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f9oB (B:)
    ivggqeaprskwpwqvslrvrdrywmhfcggslihpqwvltaahcvgpdvkdlatlrvql
    reqhlyyqdqllpvsriivhpqfyiiqtgadialleleepvnissrvhtvmlppasetfp
    pgmpcwvtgwgdvdndeplpppfplkqvkvpimenhicdakyhlgaytgddvriirddml
    cagnsqrdsckgdsggplvckvngtwlqagvvswgegcaqpnrpgiytrvtyyldwihhy
    vp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2f9oC (C:)
    ivggqeaprskwpwqvslrvrdrywmhfcggslihpqwvltaahcvgpdvkdlatlrvql
    reqhlyyqdqllpvsriivhpqfyiiqtgadialleleepvnissrvhtvmlppasetfp
    pgmpcwvtgwgdvdndeplpppfplkqvkvpimenhicdakyhlgaytgddvriirddml
    cagnsqrdsckgdsggplvckvngtwlqagvvswgegcaqpnrpgiytrvtyyldwihhy
    vpkkp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f9oC (C:)
    ivggqeaprskwpwqvslrvrdrywmhfcggslihpqwvltaahcvgpdvkdlatlrvql
    reqhlyyqdqllpvsriivhpqfyiiqtgadialleleepvnissrvhtvmlppasetfp
    pgmpcwvtgwgdvdndeplpppfplkqvkvpimenhicdakyhlgaytgddvriirddml
    cagnsqrdsckgdsggplvckvngtwlqagvvswgegcaqpnrpgiytrvtyyldwihhy
    vpk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2f9oD (D:)
    ivggqeaprskwpwqvslrvrdrywmhfcggslihpqwvltaahcvgpdvkdlatlrvql
    reqhlyyqdqllpvsriivhpqfyiiqtgadialleleepvnissrvhtvmlppasetfp
    pgmpcwvtgwgdvdndeplpppfplkqvkvpimenhicdakyhlgaytgddvriirddml
    cagnsqrdsckgdsggplvckvngtwlqagvvswgegcaqpnrpgiytrvtyyldwihhy
    vpkkp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f9oD (D:)
    ivggqeaprskwpwqvslrvrdrywmhfcggslihpqwvltaahcvgpdvkdlatlrvql
    reqhlyyqdqllpvsriivhpqfyiiqtgadialleleepvnissrvhtvmlppasetfp
    pgmpcwvtgwgdvdndeplpppfplkqvkvpimenhicdakyhlgaytgddvriirddml
    cagnsqrdsckgdsggplvckvngtwlqagvvswgegcaqpnrpgiytrvtyyldwihhy
    vpk