PDB entry 2f9n

View 2f9n on RCSB PDB site
Description: Crystal Structure of the Recombinant Human Alpha I Tryptase Mutant K192Q/D216G in Complex with Leupeptin
Class: hydrolase/hydrolase inhibitor
Keywords: serine proteinase, leupeptin, trypsin-like, difucosylation, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2005-12-06, released 2006-01-31
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.19
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alpha I tryptase
    Species: Homo sapiens [TaxId:9606]
    Gene: TPS1, TPS2, TPSAB1, TPSB1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15157 (0-End)
      • engineered (45)
      • variant (184-185)
      • engineered (190)
      • engineered (214)
    Domains in SCOPe 2.01: d2f9na_
  • Chain 'B':
    Compound: alpha I tryptase
    Species: Homo sapiens [TaxId:9606]
    Gene: TPS1, TPS2, TPSAB1, TPSB1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15157 (0-End)
      • engineered (45)
      • variant (184-185)
      • engineered (190)
      • engineered (214)
    Domains in SCOPe 2.01: d2f9nb_
  • Chain 'C':
    Compound: alpha I tryptase
    Species: Homo sapiens [TaxId:9606]
    Gene: TPS1, TPS2, TPSAB1, TPSB1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15157 (0-End)
      • engineered (45)
      • variant (184-185)
      • engineered (190)
      • engineered (214)
    Domains in SCOPe 2.01: d2f9nc_
  • Chain 'D':
    Compound: alpha I tryptase
    Species: Homo sapiens [TaxId:9606]
    Gene: TPS1, TPS2, TPSAB1, TPSB1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15157 (0-End)
      • engineered (45)
      • variant (184-185)
      • engineered (190)
      • engineered (214)
    Domains in SCOPe 2.01: d2f9nd_
  • Chain 'E':
    Compound: leupeptin
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • NOR NOR00487 (Start-2)
  • Chain 'F':
    Compound: leupeptin
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • NOR NOR00487 (Start-2)
  • Chain 'G':
    Compound: leupeptin
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • NOR NOR00487 (Start-2)
  • Chain 'H':
    Compound: leupeptin
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • NOR NOR00487 (Start-2)
  • Heterogens: NAG, BU3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2f9nA (A:)
    ivggqeaprskwpwqvslrvrdrywmhfcggslihpqwvltaahcvgpdvkdlatlrvql
    reqhlyyqdqllpvsriivhpqfyiiqtgadialleleepvnissrvhtvmlppasetfp
    pgmpcwvtgwgdvdndeplpppfplkqvkvpimenhicdakyhlgaytgddvriirddml
    cagnsqrdscqgdsggplvckvngtwlqagvvswgegcaqpnrpgiytrvtyyldwihhy
    vpkkp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f9nA (A:)
    ivggqeaprskwpwqvslrvrdrywmhfcggslihpqwvltaahcvgpdvkdlatlrvql
    reqhlyyqdqllpvsriivhpqfyiiqtgadialleleepvnissrvhtvmlppasetfp
    pgmpcwvtgwgdvdndeplpppfplkqvkvpimenhicdakyhlgaytgddvriirddml
    cagnsqrdscqgdsggplvckvngtwlqagvvswgegcaqpnrpgiytrvtyyldwihhy
    vpk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2f9nB (B:)
    ivggqeaprskwpwqvslrvrdrywmhfcggslihpqwvltaahcvgpdvkdlatlrvql
    reqhlyyqdqllpvsriivhpqfyiiqtgadialleleepvnissrvhtvmlppasetfp
    pgmpcwvtgwgdvdndeplpppfplkqvkvpimenhicdakyhlgaytgddvriirddml
    cagnsqrdscqgdsggplvckvngtwlqagvvswgegcaqpnrpgiytrvtyyldwihhy
    vpkkp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f9nB (B:)
    ivggqeaprskwpwqvslrvrdrywmhfcggslihpqwvltaahcvgpdvkdlatlrvql
    reqhlyyqdqllpvsriivhpqfyiiqtgadialleleepvnissrvhtvmlppasetfp
    pgmpcwvtgwgdvdndeplpppfplkqvkvpimenhicdakyhlgaytgddvriirddml
    cagnsqrdscqgdsggplvckvngtwlqagvvswgegcaqpnrpgiytrvtyyldwihhy
    vpk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2f9nC (C:)
    ivggqeaprskwpwqvslrvrdrywmhfcggslihpqwvltaahcvgpdvkdlatlrvql
    reqhlyyqdqllpvsriivhpqfyiiqtgadialleleepvnissrvhtvmlppasetfp
    pgmpcwvtgwgdvdndeplpppfplkqvkvpimenhicdakyhlgaytgddvriirddml
    cagnsqrdscqgdsggplvckvngtwlqagvvswgegcaqpnrpgiytrvtyyldwihhy
    vpkkp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f9nC (C:)
    ivggqeaprskwpwqvslrvrdrywmhfcggslihpqwvltaahcvgpdvkdlatlrvql
    reqhlyyqdqllpvsriivhpqfyiiqtgadialleleepvnissrvhtvmlppasetfp
    pgmpcwvtgwgdvdndeplpppfplkqvkvpimenhicdakyhlgaytgddvriirddml
    cagnsqrdscqgdsggplvckvngtwlqagvvswgegcaqpnrpgiytrvtyyldwihhy
    vpk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2f9nD (D:)
    ivggqeaprskwpwqvslrvrdrywmhfcggslihpqwvltaahcvgpdvkdlatlrvql
    reqhlyyqdqllpvsriivhpqfyiiqtgadialleleepvnissrvhtvmlppasetfp
    pgmpcwvtgwgdvdndeplpppfplkqvkvpimenhicdakyhlgaytgddvriirddml
    cagnsqrdscqgdsggplvckvngtwlqagvvswgegcaqpnrpgiytrvtyyldwihhy
    vpkkp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f9nD (D:)
    ivggqeaprskwpwqvslrvrdrywmhfcggslihpqwvltaahcvgpdvkdlatlrvql
    reqhlyyqdqllpvsriivhpqfyiiqtgadialleleepvnissrvhtvmlppasetfp
    pgmpcwvtgwgdvdndeplpppfplkqvkvpimenhicdakyhlgaytgddvriirddml
    cagnsqrdscqgdsggplvckvngtwlqagvvswgegcaqpnrpgiytrvtyyldwihhy
    vpk
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.