PDB entry 2f9l

View 2f9l on RCSB PDB site
Description: 3D structure of inactive human Rab11b GTPase
Class: hydrolase
Keywords: Rab11b GTPase, vesicle transport, HYDROLASE
Deposited on 2005-12-06, released 2006-04-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: N/A
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RAB11B, member RAS oncogene family
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q15907 (1-End)
      • initiating methionine (0)
    Domains in SCOPe 2.07: d2f9la1
  • Heterogens: MG, GDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2f9lA (A:)
    mydylfkvvligdsgvgksnllsrftrnefnleskstigvefatrsiqvdgktikaqiwd
    tagqeryrritsayyrgavgallvydiakhltyenverwlkelrdhadsnivimlvgnks
    dlrhlravptdearafaeknnlsfietsaldstnveeafknilteiyrivsqkqiadraa
    hdespgnnvvdisvppttd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f9lA (A:)
    mydylfkvvligdsgvgksnllsrftrnefnlstigvefatrsiqvdgktikaqiwdtag
    qeryrritsayyrgavgallvydiakhltyenverwlkelrdhadsnivimlvgnksdlr
    hlravptdearafaeknnlsfietsaldstnveeafknilteiyrivsqkqia