PDB entry 2f9j

View 2f9j on RCSB PDB site
Description: 3.0 angstrom resolution structure of a Y22M mutant of the spliceosomal protein p14 bound to a region of SF3b155
Class: RNA Binding Protein
Keywords: SF3bp14 SF3b155 SAP155 p14Y22M RRM, RNA Binding Protein
Deposited on 2005-12-06, released 2006-01-24
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.221
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pre-mRNA branch site protein p14
    Species: Homo sapiens [TaxId:9606]
    Gene: SF3B14
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9Y3B4 (Start-124)
      • engineered (21)
    Domains in SCOPe 2.06: d2f9ja1
  • Chain 'B':
    Compound: Pre-mRNA branch site protein p14
    Species: Homo sapiens [TaxId:9606]
    Gene: SF3B14
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9Y3B4 (Start-124)
      • engineered (21)
    Domains in SCOPe 2.06: d2f9jb_
  • Chain 'P':
    Compound: Splicing factor 3B subunit 1
    Species: Homo sapiens [TaxId:9606]
    Gene: SF3B1, SAP155
    Database cross-references and differences (RAF-indexed):
  • Chain 'Q':
    Compound: Splicing factor 3B subunit 1
    Species: Homo sapiens [TaxId:9606]
    Gene: SF3B1, SAP155
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2f9jA (A:)
mamqaakranirlppevnrilmirnlpykitaeemydifgkygpirqirvgntpetrgta
yvvyedifdaknacdhlsgfnvcnrylvvlyynanrafqkmdtkkkeeqlkllkekygin
tdppk

    Sequence, based on observed residues (ATOM records): (download) 
    >2f9jA (A:)
rlppevnrilmirnlpykitaeemydifgkygpirqirvgntpetrgtayvvyedifdak
nacdhlsgfnvcnrylvvlyynanrafqkmdtkkkeeqlkllkekygintdppk

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >2f9jB (B:)
mamqaakranirlppevnrilmirnlpykitaeemydifgkygpirqirvgntpetrgta
yvvyedifdaknacdhlsgfnvcnrylvvlyynanrafqkmdtkkkeeqlkllkekygin
tdppk

    Sequence, based on observed residues (ATOM records): (download) 
    >2f9jB (B:)
rlppevnrilmirnlpykitaeemydifgkygpirqirvgntpetrgtayvvyedifdak
nacdhlsgfnvcnrylvvlyynanrafqkmdtkkkeeqlkllkekygintdppk

  • Chain 'P':
    No sequence available.

  • Chain 'Q':
    No sequence available.