PDB entry 2f9h

View 2f9h on RCSB PDB site
Description: The Crystal Structure of PTS System IIA Component from Enterococcus faecalis V583
Class: structural genomics, unknown function
Keywords: alpha-beta structure, beta-barrel, dimer, Structural Genomics, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, UNKNOWN FUNCTION
Deposited on 2005-12-05, released 2006-01-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.57 Å
R-factor: 0.169
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: PTS system, IIA component
    Species: Enterococcus faecalis [TaxId:226185]
    Database cross-references and differences (RAF-indexed):
    • GB NP_816242
      • modified residue (7)
      • modified residue (25)
    Domains in SCOPe 2.07: d2f9ha1
  • Chain 'B':
    Compound: PTS system, IIA component
    Species: Enterococcus faecalis [TaxId:226185]
    Database cross-references and differences (RAF-indexed):
    • GB NP_816242
      • modified residue (7)
      • modified residue (25)
    Domains in SCOPe 2.07: d2f9hb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2f9hA (A:)
    snamgwkmqatvteigkhaiddsekmiilfgetatdtlkqhaviqsfpekdqvtlaegdh
    lkigdtnytitkvgsfansnlqsiahstlifadaptdeddvirngvyltphqlpkitigt
    tidylvnga
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f9hA (A:)
    wkmqatvteigkhaiddsekmiilfgetatdtlkqhaviqsfpekdqvtlaegdhlkigd
    tnytitkvgsfansnlqsiahstlifadaptdeddvirngvyltphqlpkitigttidyl
    v
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2f9hB (B:)
    snamgwkmqatvteigkhaiddsekmiilfgetatdtlkqhaviqsfpekdqvtlaegdh
    lkigdtnytitkvgsfansnlqsiahstlifadaptdeddvirngvyltphqlpkitigt
    tidylvnga
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f9hB (B:)
    mqatvteigkhaiddsekmiilfgetatdtlkqhaviqsfpekdqvtlaegdhlkigdtn
    ytitkvgsfansnlqsiahstlifadaptdeddvirngvyltphqlpkitigttidylv