PDB entry 2f9f

View 2f9f on RCSB PDB site
Description: Crystal Structure of the Putative Mannosyl Transferase (wbaZ-1)from Archaeoglobus fulgidus, Northeast Structural Genomics Target GR29A.
Class: transferase
Keywords: alpha-beta protein, Structural Genomics, PSI, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, TRANSFERASE
Deposited on 2005-12-05, released 2006-06-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: first mannosyl transferase (wbaZ-1)
    Species: ARCHAEOGLOBUS FULGIDUS [TaxId:224325]
    Gene: wbaZ-1
    Database cross-references and differences (RAF-indexed):
    • GB NP_068884 (Start-176)
      • modified residue (72)
      • modified residue (117)
      • modified residue (155)
    Domains in SCOPe 2.08: d2f9fa1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2f9fA (A:)
mghhhhhhshpvetskfkfkcygdfwlsvnriypekrielqlevfkklqdeklyivgwfs
kgdhaeryarkimkiapdnvkflgsvseeelidlysrckgllctakdedfgltpieamas
gkpviavneggfketvinektgylvnadvneiidamkkvsknpdkfkkdcfrrakef

    Sequence, based on observed residues (ATOM records): (download) 
    >2f9fA (A:)
vetskfkfkcygdfwlsvnriypekrielqlevfkklqdeklyivgwfskgdhaeryark
imkiapdnvkflgsvseeelidlysrckgllctakdedfgltpieamasgkpviavnegg
fketvinektgylvnadvneiidamkkvsknpdkfkkdcfrrakef