PDB entry 2f9d

View 2f9d on RCSB PDB site
Description: 2.5 angstrom resolution structure of the spliceosomal protein p14 bound to region of SF3b155
Class: RNA Binding Protein
Keywords: p14 SF3bp14 SF3b155 SAP155 RRM
Deposited on 2005-12-05, released 2006-01-24
The last revision prior to the SCOP 1.73 freeze date was dated 2006-02-14, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.224
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pre-mRNA branch site protein p14
    Species: HOMO SAPIENS
    Gene: SF3B14
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2f9da1
  • Chain 'B':
    Compound: Pre-mRNA branch site protein p14
    Species: HOMO SAPIENS
    Gene: SF3B14
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2f9db1
  • Chain 'P':
    Compound: Splicing factor 3B subunit 1
    Species: HOMO SAPIENS
    Gene: SF3B1, SAP155
    Database cross-references and differences (RAF-indexed):
    • Uniprot O75533 (Start-42)
      • modified residue (5)
      • modified residue (34)
  • Chain 'Q':
    Compound: Splicing factor 3B subunit 1
    Species: HOMO SAPIENS
    Gene: SF3B1, SAP155
    Database cross-references and differences (RAF-indexed):
    • Uniprot O75533 (Start-42)
      • modified residue (5)
      • modified residue (34)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2f9dA (A:)
    mamqaakranirlppevnrilyirnlpykitaeemydifgkygpirqirvgntpetrgta
    yvvyedifdaknacdhlsgfnvcnrylvvlyynanrafqkmdtkkkeeqlkllkekygin
    tdppk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f9dA (A:)
    rlppevnrilyirnlpykitaeemydifgkygpirqirvgntpetrgtayvvyedifdak
    nacdhlsgfnvcnrylvvlyynanrafqkmdtkkkeeqlkllkekygintdppk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2f9dB (B:)
    mamqaakranirlppevnrilyirnlpykitaeemydifgkygpirqirvgntpetrgta
    yvvyedifdaknacdhlsgfnvcnrylvvlyynanrafqkmdtkkkeeqlkllkekygin
    tdppk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f9dB (B:)
    rlppevnrilyirnlpykitaeemydifgkygpirqirvgntpetrgtayvvyedifdak
    nacdhlsgfnvcnrylvvlyynanrafqkmdtkkkeeqlkllkekygintdppk
    

  • Chain 'P':
    No sequence available.

  • Chain 'Q':
    No sequence available.