PDB entry 2f98

View 2f98 on RCSB PDB site
Description: Crystal structure of the polyketide cyclase AknH with bound substrate and product analogue: implications for catalytic mechanism and product stereoselectivity.
Class: biosynthetic protein
Keywords: anthracycline, polyketide cyclase, stereoselectivity, aklavinone, BIOSYNTHETIC PROTEIN
Deposited on 2005-12-05, released 2006-02-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.195
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Aklanonic Acid methyl Ester Cyclase, AknH
    Species: Streptomyces galilaeus [TaxId:33899]
    Database cross-references and differences (RAF-indexed):
    • GB AAF70112 (10-End)
      • cloning artifact (9)
    Domains in SCOPe 2.07: d2f98a1, d2f98a2
  • Chain 'B':
    Compound: Aklanonic Acid methyl Ester Cyclase, AknH
    Species: Streptomyces galilaeus [TaxId:33899]
    Database cross-references and differences (RAF-indexed):
    • GB AAF70112 (10-End)
      • cloning artifact (9)
    Domains in SCOPe 2.07: d2f98b2, d2f98b3
  • Chain 'C':
    Compound: Aklanonic Acid methyl Ester Cyclase, AknH
    Species: Streptomyces galilaeus [TaxId:33899]
    Database cross-references and differences (RAF-indexed):
    • GB AAF70112 (10-End)
      • cloning artifact (9)
    Domains in SCOPe 2.07: d2f98c2, d2f98c3
  • Chain 'D':
    Compound: Aklanonic Acid methyl Ester Cyclase, AknH
    Species: Streptomyces galilaeus [TaxId:33899]
    Database cross-references and differences (RAF-indexed):
    • GB AAF70112 (10-End)
    Domains in SCOPe 2.07: d2f98d_
  • Heterogens: SO4, NGV, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2f98A (A:)
    mahhhhhhhrseqiaavrrmveayntgktddvadyihpeymnpgtleftslrgpelfain
    vawvkktfseearleevgieeradwvrarlvlygrhvgemvgmaptgrlfsgeqihllhf
    vdgkihhhrdwpdyqgtyrqlgepwpetehrrp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f98A (A:)
    rseqiaavrrmveayntgktddvadyihpeymnpgtleftslrgpelfainvawvkktfs
    eearleevgieeradwvrarlvlygrhvgemvgmaptgrlfsgeqihllhfvdgkihhhr
    dwpdyqgtyrqlgepwpeteh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2f98B (B:)
    mahhhhhhhrseqiaavrrmveayntgktddvadyihpeymnpgtleftslrgpelfain
    vawvkktfseearleevgieeradwvrarlvlygrhvgemvgmaptgrlfsgeqihllhf
    vdgkihhhrdwpdyqgtyrqlgepwpetehrrp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f98B (B:)
    rseqiaavrrmveayntgktddvadyihpeymnpgtleftslrgpelfainvawvkktfs
    eearleevgieeradwvrarlvlygrhvgemvgmaptgrlfsgeqihllhfvdgkihhhr
    dwpdyqgtyrqlgepwpeteh
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2f98C (C:)
    mahhhhhhhrseqiaavrrmveayntgktddvadyihpeymnpgtleftslrgpelfain
    vawvkktfseearleevgieeradwvrarlvlygrhvgemvgmaptgrlfsgeqihllhf
    vdgkihhhrdwpdyqgtyrqlgepwpetehrrp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f98C (C:)
    rseqiaavrrmveayntgktddvadyihpeymnpgtleftslrgpelfainvawvkktfs
    eearleevgieeradwvrarlvlygrhvgemvgmaptgrlfsgeqihllhfvdgkihhhr
    dwpdyqgtyrqlgepwpetehrr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2f98D (D:)
    mahhhhhhhrseqiaavrrmveayntgktddvadyihpeymnpgtleftslrgpelfain
    vawvkktfseearleevgieeradwvrarlvlygrhvgemvgmaptgrlfsgeqihllhf
    vdgkihhhrdwpdyqgtyrqlgepwpetehrrp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f98D (D:)
    seqiaavrrmveayntgktddvadyihpeymnpgtleftslrgpelfainvawvkktfse
    earleevgieeradwvrarlvlygrhvgemvgmaptgrlfsgeqihllhfvdgkihhhrd
    wpdyqgtyrqlgepwpeteh