PDB entry 2f91

View 2f91 on RCSB PDB site
Description: 1.2A resolution structure of a crayfish trypsin complexed with a peptide inhibitor, SGTI
Class: hydrolase/hydrolase inhibitor
Keywords: serine protease, trypsin, canonical inhibitor, atomic resolution, hydrolase/hydrolase inhibitor complex
Deposited on 2005-12-05, released 2006-04-18
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: 0.139
AEROSPACI score: 0.85 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hepatopancreas trypsin
    Species: Pontastacus leptodactylus [TaxId:6717]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q52V24 (0-236)
      • variant (46)
    Domains in SCOPe 2.02: d2f91a1
  • Chain 'B':
    Compound: Serine protease inhibitor I/II
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Heterogens: CD, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2f91A (A:)
    ivggtdatlgefpyqlsfqetfigfsfhfcgasiynenyaitaghcvygddyenpsglqi
    vageldmsvnegseqiitvskiilhenfdynlldndisllklsgsltfndnvapialpeq
    ghtatgdvivtgwgttseggntpdvlqkvtvplvsdedcradygadeildsmicagvpeg
    gkdscqgdsggplaasdtgstylagivswgygcarpgypgvytevsyhvdwikanav
    

  • Chain 'B':
    No sequence available.