PDB entry 2f8v

View 2f8v on RCSB PDB site
Description: Structure of full length telethonin in complex with the N-terminus of titin
Class: contractile protein/contractile protein
Keywords: Sarcomere, Titin, Z1Z2, Telethonin, CONTRACTILE PROTEIN-CONTRACTILE PROTEIN COMPLEX
Deposited on 2005-12-04, released 2006-06-27
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-07-25, with a file datestamp of 2012-07-20.
Experiment type: XRAY
Resolution: 2.75 Å
R-factor: 0.267
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: N2B-Titin Isoform
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2f8va1, d2f8va2
  • Chain 'B':
    Compound: N2B-Titin Isoform
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8WZ42 (0-195)
      • cloning artifact (196)
    Domains in SCOPe 2.06: d2f8vb1, d2f8vb2, d2f8vb3
  • Chain 'C':
    Compound: N2B-Titin Isoform
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2f8vc1, d2f8vc2
  • Chain 'D':
    Compound: N2B-Titin Isoform
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2f8vd1, d2f8vd2
  • Chain 'T':
    Compound: Telethonin
    Species: Homo sapiens [TaxId:9606]
    Gene: TCAP
    Database cross-references and differences (RAF-indexed):
    • Uniprot O15273 (0-End)
      • engineered (7)
      • engineered (14)
      • engineered (37)
      • engineered (56)
  • Chain 'Y':
    Compound: Telethonin
    Species: Homo sapiens [TaxId:9606]
    Gene: TCAP
    Database cross-references and differences (RAF-indexed):
    • Uniprot O15273 (0-End)
      • engineered (7)
      • engineered (14)
      • engineered (37)
      • engineered (56)
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2f8vA (A:)
    mttqaptftqplqsvvvlegstatfeahisgfpvpevswfrdgqviststlpgvqisfsd
    grakltipavtkansgryslkatngsgqatstaellvkaetappnfvqrlqsmtvrqgsq
    vrlqvrvtgiptpvvkfyrdgaeiqssldfqisqegdlyslliaeaypedsgtysvnatn
    svgratstaellvqgetreef
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f8vA (A:)
    ttqaptftqplqsvvvlegstatfeahisgfpvpevswfrdgqviststlpgvqisfsdg
    rakltipavtkansgryslkatngsgqatstaellvkaetappnfvqrlqsmtvrqgsqv
    rlqvrvtgiptpvvkfyrdgaeiqssldfqisqegdlyslliaeaypedsgtysvnatns
    vgratstaellvqg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2f8vB (B:)
    mttqaptftqplqsvvvlegstatfeahisgfpvpevswfrdgqviststlpgvqisfsd
    grakltipavtkansgryslkatngsgqatstaellvkaetappnfvqrlqsmtvrqgsq
    vrlqvrvtgiptpvvkfyrdgaeiqssldfqisqegdlyslliaeaypedsgtysvnatn
    svgratstaellvqgetreef
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f8vB (B:)
    mttqaptftqplqsvvvlegstatfeahisgfpvpevswfrdgqviststlpgvqisfsd
    grakltipavtkansgryslkatngsgqatstaellvkaetappnfvqrlqsmtvrqgsq
    vrlqvrvtgiptpvvkfyrdgaeiqssldfqisqegdlyslliaeaypedsgtysvnatn
    svgratstaellvqget
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2f8vC (C:)
    mttqaptftqplqsvvvlegstatfeahisgfpvpevswfrdgqviststlpgvqisfsd
    grakltipavtkansgryslkatngsgqatstaellvkaetappnfvqrlqsmtvrqgsq
    vrlqvrvtgiptpvvkfyrdgaeiqssldfqisqegdlyslliaeaypedsgtysvnatn
    svgratstaellvqgetreef
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f8vC (C:)
    qaptftqplqsvvvlegstatfeahisgfpvpevswfrdgqviststlpgvqisfsdgra
    kltipavtkansgryslkatngsgqatstaellvkaetappnfvqrlqsmtvrqgsqvrl
    qvrvtgiptpvvkfyrdgaeiqssldfqisqegdlyslliaeaypedsgtysvnatnsvg
    ratstaellvq
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2f8vD (D:)
    mttqaptftqplqsvvvlegstatfeahisgfpvpevswfrdgqviststlpgvqisfsd
    grakltipavtkansgryslkatngsgqatstaellvkaetappnfvqrlqsmtvrqgsq
    vrlqvrvtgiptpvvkfyrdgaeiqssldfqisqegdlyslliaeaypedsgtysvnatn
    svgratstaellvqgetreef
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f8vD (D:)
    ttqaptftqplqsvvvlegstatfeahisgfpvpevswfrdgqviststlpgvqisfsdg
    rakltipavtkansgryslkatngsgqatstaellvkaetappnfvqrlqsmtvrqgsqv
    rlqvrvtgiptpvvkfyrdgaeiqssldfqisqegdlyslliaeaypedsgtysvnatns
    vgratstaellvq
    

  • Chain 'T':
    No sequence available.

  • Chain 'Y':
    No sequence available.