PDB entry 2f8s

View 2f8s on RCSB PDB site
Description: Crystal structure of Aa-Ago with externally-bound siRNA
Class: RNA binding protein/RNA
Keywords: Argonaute, siRNA, RISC loading complex, RNA BINDING PROTEIN-RNA COMPLEX
Deposited on 2005-12-03, released 2006-10-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.217
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Argonaute protein
    Species: Aquifex aeolicus [TaxId:63363]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2f8sa1, d2f8sa3, d2f8sa4
  • Chain 'B':
    Compound: Argonaute protein
    Species: Aquifex aeolicus [TaxId:63363]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2f8sb1, d2f8sb3, d2f8sb4
  • Chain 'C':
    Compound: 5'-r(p*ap*gp*ap*cp*ap*gp*cp*ap*up*ap*up*ap*up*gp*cp*up*gp*up*cp*up*up*u)-3'
  • Chain 'D':
    Compound: 5'-r(p*ap*gp*ap*cp*ap*gp*cp*ap*up*ap*up*ap*up*gp*cp*up*gp*up*cp*up*up*u)-3'
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2f8sA (A:)
    mgkeallnlyrieyrpkdttftvfkptheiqkeklnkvrwrvflqtglptfrredefwca
    gkvekdtlyltlsngeivelkrvgeeefrgfqnerecqelfrdfltktkvkdkfisdfyk
    kfrdkitvqgknrkialipevnekvlkseegyfllhldlkfriqpfetlqtllerndfnp
    krirvkpigidfvgrvqdvfkakekgeeffrlcmersthksskkaweellknrelrekaf
    lvvlekgytypatilkpvltyenledeernevadivrmepgkrlnliryilrryvkalrd
    ygwyispeeerakgklnfkdtvldakgkntkvitnlrkflelcrpfvkkdvlsveiisvs
    vykklewrkeeflkelinflknkgiklkikgkslilaqtreeakeklipvinkikdvdlv
    ivfleeypkvdpyksfllydfvkrellkkmipsqvilnrtlknenlkfvllnvaeqvlak
    tgnipyklkeiegkvdafvgidisritrdgktvnavaftkifnskgelvryyltsypafg
    ekltekaigdvfslleklgfkkgskivvhrdgrlyrdevaafkkygelygyslelleiik
    rnnprffsnekfikgyfyklsedsvilatynqvyegthqpikvrkvygelpvevlcsqil
    sltlmnyssfqpiklpatvhysdkitklmlrgiepikkegdimywl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f8sA (A:)
    keallnlyrieyrpkdttftvfkptheiqkeklnkvrwrvflqtglptfrredefwcagk
    vekdtlyltlsngeivelkrvgeeefrgfqnerecqelfrdfltktkvkdkfisdfykkf
    rdkitvqgknrkialipevnekvlkseegyfllhldlkfriqpfetlqtllerndfnpkr
    irvkpigidfvgrvqdvfkakekgeeffrlcmersthksskkaweellknrelrekaflv
    vlekgytypatilkpvltyenledeernevadivrmepgkrlnliryilrryvkalrdyg
    wyispeeerakgklnfkdtvldakgkntkvitnlrkflelcrpfvkkdvlsveiisvsvy
    kklewrkeeflkelinflknkgiklkikgkslilaqtreeakeklipvinkikdvdlviv
    fleeypkvdpyksfllydfvkrellkkmipsqvilnrtlknenlkfvllnvaeqvlaktg
    nipyklkeiegkvdafvgidisritrdgktvnavaftkifnskgelvryyltsypafgek
    ltekaigdvfslleklgfkkgskivvhrdgrlyrdevaafkkygelygyslelleiikrn
    nprffsnekfikgyfyklsedsvilatynqvyegthqpikvrkvygelpvevlcsqilsl
    tlmnyssfqpiklpatvhysdkitklmlrgiepikkegdimywl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2f8sB (B:)
    mgkeallnlyrieyrpkdttftvfkptheiqkeklnkvrwrvflqtglptfrredefwca
    gkvekdtlyltlsngeivelkrvgeeefrgfqnerecqelfrdfltktkvkdkfisdfyk
    kfrdkitvqgknrkialipevnekvlkseegyfllhldlkfriqpfetlqtllerndfnp
    krirvkpigidfvgrvqdvfkakekgeeffrlcmersthksskkaweellknrelrekaf
    lvvlekgytypatilkpvltyenledeernevadivrmepgkrlnliryilrryvkalrd
    ygwyispeeerakgklnfkdtvldakgkntkvitnlrkflelcrpfvkkdvlsveiisvs
    vykklewrkeeflkelinflknkgiklkikgkslilaqtreeakeklipvinkikdvdlv
    ivfleeypkvdpyksfllydfvkrellkkmipsqvilnrtlknenlkfvllnvaeqvlak
    tgnipyklkeiegkvdafvgidisritrdgktvnavaftkifnskgelvryyltsypafg
    ekltekaigdvfslleklgfkkgskivvhrdgrlyrdevaafkkygelygyslelleiik
    rnnprffsnekfikgyfyklsedsvilatynqvyegthqpikvrkvygelpvevlcsqil
    sltlmnyssfqpiklpatvhysdkitklmlrgiepikkegdimywl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f8sB (B:)
    keallnlyrieyrpkdttftvfkptheiqkeklnkvrwrvflqtglptfrredefwcagk
    vekdtlyltlsngeivelkrvgeeefrgfqnerecqelfrdfltktkvkdkfisdfykkf
    rdkitvqgknrkialipevnekvlkseegyfllhldlkfriqpfetlqtllerndfnpkr
    irvkpigidfvgrvqdvfkakekgeeffrlcmersthksskkaweellknrelrekaflv
    vlekgytypatilkpvltyenledeernevadivrmepgkrlnliryilrryvkalrdyg
    wyispeeerakgklnfkdtvldakgkntkvitnlrkflelcrpfvkkdvlsveiisvsvy
    kklewrkeeflkelinflknkgiklkikgkslilaqtreeakeklipvinkikdvdlviv
    fleeypkvdpyksfllydfvkrellkkmipsqvilnrtlknenlkfvllnvaeqvlaktg
    nipyklkeiegkvdafvgidisritrdgktvnavaftkifnskgelvryyltsypafgek
    ltekaigdvfslleklgfkkgskivvhrdgrlyrdevaafkkygelygyslelleiikrn
    nprffsnekfikgyfyklsedsvilatynqvyegthqpikvrkvygelpvevlcsqilsl
    tlmnyssfqpiklpatvhysdkitklmlrgiepikkegdimywl
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.