PDB entry 2f8o

View 2f8o on RCSB PDB site
Description: A Native to Amyloidogenic Transition Regulated by a Backbone Trigger
Class: immune system
Keywords: beta-sandwich, amyloid, class-1 MHC, IMMUNE SYSTEM
Deposited on 2005-12-02, released 2006-02-21
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.186
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-2-microglobulin
    Species: Homo sapiens [TaxId:9606]
    Gene: B2M
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61769
      • engineered (32)
    Domains in SCOPe 2.03: d2f8oa_
  • Chain 'B':
    Compound: Beta-2-microglobulin
    Species: Homo sapiens [TaxId:9606]
    Gene: B2M
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61769
      • engineered (32)
    Domains in SCOPe 2.03: d2f8ob_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2f8oA (A:)
    miqrtpkiqvysrhpaengksnflncyvsgfhasdievdllkngeriekvehsdlsfskd
    wsfyllyyteftptekdeyacrvnhvtlsqpkivkwdrdm
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f8oA (A:)
    tpkiqvysrhpaengksnflncyvsgfhasdievdllkngeriekvehsdlsfskdwsfy
    llyyteftptekdeyacrvnhvtlsqpkivkwdr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2f8oB (B:)
    miqrtpkiqvysrhpaengksnflncyvsgfhasdievdllkngeriekvehsdlsfskd
    wsfyllyyteftptekdeyacrvnhvtlsqpkivkwdrdm
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f8oB (B:)
    tpkiqvysrhpaengksnflncyvsgfhasdievdllkngeriekvehsdlsfskdwsfy
    llyyteftptekdeyacrvnhvtlsqpkivkwdr