PDB entry 2f8n

View 2f8n on RCSB PDB site
Description: 2.9 Angstrom X-ray structure of hybrid macroH2A nucleosomes
Class: structural protein/DNA
Keywords: Nucleosome, NCP, macroH2A, Histone variant, chromatin, X-ray structure, crystallography
Deposited on 2005-12-02, released 2006-05-23
The last revision prior to the SCOP 1.73 freeze date was dated 2006-05-23, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.217
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Histone H3.1
    Species: Xenopus laevis
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2f8na1
  • Chain 'B':
    Compound: histone h4
    Species: Xenopus laevis
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2f8nb1
  • Chain 'D':
    Compound: Histone 3, H2ba
    Species: MUS MUSCULUS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2f8nd1
  • Chain 'E':
    Compound: Histone H3.1
    Species: Xenopus laevis
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2f8ne1
  • Chain 'F':
    Compound: histone h4
    Species: Xenopus laevis
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2f8nf1
  • Chain 'G':
    Compound: Core histone macro-H2A.1
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • Uniprot O75367
      • conflict (64)
    Domains in SCOP 1.73: d2f8ng1
  • Chain 'H':
    Compound: Histone H2B.1
    Species: Xenopus laevis
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2f8nh1
  • Chain 'I':
    Compound: alpha-satellite DNA (146 bp)
    Species: HOMO SAPIENS
  • Chain 'J':
    Compound: alpha-satellite DNA (146 bp)
    Species: HOMO SAPIENS
  • Chain 'K':
    Compound: Histone H2A type 1
    Species: MUS MUSCULUS
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2f8nA (A:)
    martkqtarkstggkaprkqlatkaarksapatggvkkphryrpgtvalreirryqkste
    llirklpfqrlvreiaqdfktdlrfqssavmalqeaseaylvglfedtnlcaihakrvti
    mpkdiqlarrirgera
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f8nA (A:)
    phryrpgtvalreirryqkstellirklpfqrlvreiaqdfktdlrfqssavmalqease
    aylvglfedtnlcaihakrvtimpkdiqlarrirgera
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2f8nB (B:)
    msgrgkggkglgkggakrhrkvlrdniqgitkpairrlarrggvkrisgliyeetrgvlk
    vflenvirdavtytehakrktvtamdvvyalkrqgrtlygfgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f8nB (B:)
    dniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehakrktvta
    mdvvyalkrqgrtlygfgg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2f8nD (D:)
    mpepsrstpapkkgskkaitkaqkkdgkkrkrgrkesysiyvykvlkqvhpdtgisskam
    gimnsfvndiferiaseasrlahynkrstitsrevqtavrlllpgelakhavsegtkavt
    kytssk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f8nD (D:)
    rkesysiyvykvlkqvhpdtgisskamgimnsfvndiferiaseasrlahynkrstitsr
    evqtavrlllpgelakhavsegtkavtkytssk
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2f8nE (E:)
    martkqtarkstggkaprkqlatkaarksapatggvkkphryrpgtvalreirryqkste
    llirklpfqrlvreiaqdfktdlrfqssavmalqeaseaylvglfedtnlcaihakrvti
    mpkdiqlarrirgera
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f8nE (E:)
    phryrpgtvalreirryqkstellirklpfqrlvreiaqdfktdlrfqssavmalqease
    aylvglfedtnlcaihakrvtimpkdiqlarrirgera
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2f8nF (F:)
    msgrgkggkglgkggakrhrkvlrdniqgitkpairrlarrggvkrisgliyeetrgvlk
    vflenvirdavtytehakrktvtamdvvyalkrqgrtlygfgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f8nF (F:)
    rkvlrdniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehakr
    ktvtamdvvyalkrqgrtlygfgg
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2f8nG (G:)
    mssrggkkkstktsrsakagvifpvgrmlryikkghpkyrigvgapvymaavleyltaei
    lelavnaardnkkgrvtprhillavandeelnqllkgvtiasggvlpnihpellakkrgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f8nG (G:)
    stktsrsakagvifpvgrmlryikkghpkyrigvgapvymaavleyltaeilelavnaar
    dnkkgrvtprhillavandeelnqllkgvtiasggvlpnihpellakk
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2f8nH (H:)
    maksapapkkgskkavtktqkkdgkkrrktrkesyaiyvykvlkqvhpdtgisskamsim
    nsfvndvferiageasrlahynkrstitsreiqtavrlllpgelakhavsegtkavtkyt
    sak
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f8nH (H:)
    rkesyaiyvykvlkqvhpdtgisskamsimnsfvndvferiageasrlahynkrstitsr
    eiqtavrlllpgelakhavsegtkavtkytsak
    

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    No sequence available.

  • Chain 'K':
    No sequence available.