PDB entry 2f8l

View 2f8l on RCSB PDB site
Description: Crystal structure of (16411011) from Listeria monocytogenes LI2 at 2.20 A resolution
Class: structural genomics, unknown function
Keywords: 16411011, Structural Genomics, PSI, Protein Structure Initiative, Joint Center for Structural Genomics, JCSG
Deposited on 2005-12-02, released 2006-01-17
The last revision prior to the SCOP 1.73 freeze date was dated 2006-02-21, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.168
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein lmo1582
    Species: Listeria monocytogenes
    Gene: 16411011
    Database cross-references and differences (RAF-indexed):
    • GB NP_465107
      • see remark 999 (71)
      • modified residue (98)
      • modified residue (108)
      • see remark 999 (131)
      • modified residue (185)
      • modified residue (242)
      • modified residue (259)
      • see remark 999 (302)
      • see remark 999 (307)
    Domains in SCOP 1.73: d2f8la1
  • Heterogens: CL, SO4, SAM, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2f8lA (A:)
    mgsdkihhhhhhmaneatqelfqvldntaiilqneleisyleavyetgenlfqkevlqke
    elssekqlklqasyesielenfsneeirkglqlallkgmkhgiqvnhqmtpdsigfivay
    llekviqkkknvsildpacgtanllttvinqlelkgdvdvhasgvdvddllislalvgad
    lqrqkmtllhqdglanllvdpvdvvisdlpvgyypddenaktfelcreeghsfahflfie
    qgmrytkpggylfflvpdamfgtsdfakvdkfikknghiegiiklpetlfkseqarksil
    ilekadvdvkppkevllanlssltdpsvtapilaeienwfkskq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f8lA (A:)
    aneatqelfqvldntaiilqneleisyleavyetgenlfqkevlqkeekqlklqasyesi
    elenfsneeirkglqlallkgmkhgiqvnhqmtpdsigfivayllekviqkkknvsildp
    acgtanllttvinqlelkgdvdvhasgvdvddllislalvgadlqrqkmtllhqdglanl
    lvdpvdvvisdlpvgyypddenaktfelcreeghsfahflfieqgmrytkpggylfflvp
    damfgtsdfakvdkfikknghiegiiklpetlfksqarksililekadvdvkppkevlla
    nlssltdpsvtapilaeienwfk