PDB entry 2f8j

View 2f8j on RCSB PDB site
Description: Crystal structure of Histidinol-phosphate aminotransferase (EC 2.6.1.9) (Imidazole acetol-phosphate transferase) (tm1040) from Thermotoga maritima at 2.40 A resolution
Class: transferase
Keywords: tm1040, Histidinol-phosphate aminotransferase (EC 2.6.1.9) (Imidazole acetol-phosphate transferase, Structural Genomics, PSI, Protein Structure Initiative, Joint Center for Structural Genomics, JCSG, TRANSFERASE
Deposited on 2005-12-02, released 2006-02-21
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.185
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Histidinol-phosphate aminotransferase
    Species: Thermotoga maritima [TaxId:2336]
    Gene: hisC
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X0D0 (12-End)
      • leader sequence (11)
    Domains in SCOPe 2.06: d2f8ja2, d2f8ja3
  • Chain 'B':
    Compound: Histidinol-phosphate aminotransferase
    Species: Thermotoga maritima [TaxId:2336]
    Gene: hisC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2f8jb_
  • Chain 'C':
    Compound: Histidinol-phosphate aminotransferase
    Species: Thermotoga maritima [TaxId:2336]
    Gene: hisC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2f8jc_
  • Chain 'D':
    Compound: Histidinol-phosphate aminotransferase
    Species: Thermotoga maritima [TaxId:2336]
    Gene: hisC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2f8jd_
  • Heterogens: PMP, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2f8jA (A:)
    mgsdkihhhhhhmnpldliakraypyetekrdktylalnenpfpfpedlvdevfrrlnsd
    alriyydspdeeliekilsyldtdflsknnvsvgngadeiiyvmmlmfdrsvffpptysc
    yrifakavgakflevpltkdlripevnvgegdvvfipnpnnptghvfereeierilktga
    fvaldeayyefhgesyvdflkkyenlavirtfskafslaaqrvgyvvasekfidaynrvr
    lpfnvsyvsqmfakvaldhreifeertkfiveerermksalremgyritdsrgnfvfvfm
    ekeekerllehlrtknvavrsfregvritigkreendmilrelevfk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f8jA (A:)
    hmnpldliakraypyetekrdktylalnenpfpfpedlvdevfrrlnsdalriyydspde
    eliekilsyldtdflsknnvsvgngadeiiyvmmlmfdrsvffpptyscyrifakavgak
    flevpltkdlripevnvgegdvvfipnpnnptghvfereeierilktgafvaldeayyef
    hgesyvdflkkyenlavirtfskafslaaqrvgyvvasekfidaynrvrlpfnvsyvsqm
    fakvaldhreifeertkfiveerermksalremgyritdsrgnfvfvfmekeekerlleh
    lrtknvavrsfregvritigkreendmilrelevf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2f8jB (B:)
    mgsdkihhhhhhmnpldliakraypyetekrdktylalnenpfpfpedlvdevfrrlnsd
    alriyydspdeeliekilsyldtdflsknnvsvgngadeiiyvmmlmfdrsvffpptysc
    yrifakavgakflevpltkdlripevnvgegdvvfipnpnnptghvfereeierilktga
    fvaldeayyefhgesyvdflkkyenlavirtfskafslaaqrvgyvvasekfidaynrvr
    lpfnvsyvsqmfakvaldhreifeertkfiveerermksalremgyritdsrgnfvfvfm
    ekeekerllehlrtknvavrsfregvritigkreendmilrelevfk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f8jB (B:)
    npldliakraypyetekrdktylalnenpfpfpedlvdevfrrlnsdalriyydspdeel
    iekilsyldtdflsknnvsvgngadeiiyvmmlmfdrsvffpptyscyrifakavgakfl
    evpltkdlripevnvgegdvvfipnpnnptghvfereeierilktgafvaldeayyefhg
    esyvdflkkyenlavirtfskafslaaqrvgyvvasekfidaynrvrlpfnvsyvsqmfa
    kvaldhreifeertkfiveerermksalremgyritdsrgnfvfvfmekeekerllehlr
    tknvavrsfregvritigkreendmilrelevf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2f8jC (C:)
    mgsdkihhhhhhmnpldliakraypyetekrdktylalnenpfpfpedlvdevfrrlnsd
    alriyydspdeeliekilsyldtdflsknnvsvgngadeiiyvmmlmfdrsvffpptysc
    yrifakavgakflevpltkdlripevnvgegdvvfipnpnnptghvfereeierilktga
    fvaldeayyefhgesyvdflkkyenlavirtfskafslaaqrvgyvvasekfidaynrvr
    lpfnvsyvsqmfakvaldhreifeertkfiveerermksalremgyritdsrgnfvfvfm
    ekeekerllehlrtknvavrsfregvritigkreendmilrelevfk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f8jC (C:)
    mnpldliakraypyetekrdktylalnenpfpfpedlvdevfrrlnsdalriyydspdee
    liekilsyldtdflsknnvsvgngadeiiyvmmlmfdrsvffpptyscyrifakavgakf
    levpltkdlripevnvgegdvvfipnpnnptghvfereeierilktgafvaldeayyefh
    gesyvdflkkyenlavirtfskafslaaqrvgyvvasekfidaynrvrlpfnvsyvsqmf
    akvaldhreifeertkfiveerermksalremgyritdsrgnfvfvfmekeekerllehl
    rtknvavrsfregvritigkreendmilrelevfk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2f8jD (D:)
    mgsdkihhhhhhmnpldliakraypyetekrdktylalnenpfpfpedlvdevfrrlnsd
    alriyydspdeeliekilsyldtdflsknnvsvgngadeiiyvmmlmfdrsvffpptysc
    yrifakavgakflevpltkdlripevnvgegdvvfipnpnnptghvfereeierilktga
    fvaldeayyefhgesyvdflkkyenlavirtfskafslaaqrvgyvvasekfidaynrvr
    lpfnvsyvsqmfakvaldhreifeertkfiveerermksalremgyritdsrgnfvfvfm
    ekeekerllehlrtknvavrsfregvritigkreendmilrelevfk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f8jD (D:)
    npldliakraypyetekrdktylalnenpfpfpedlvdevfrrlnsdalriyydspdeel
    iekilsyldtdflsknnvsvgngadeiiyvmmlmfdrsvffpptyscyrifakavgakfl
    evpltkdlripevnvgegdvvfipnpnnptghvfereeierilktgafvaldeayyefhg
    esyvdflkkyenlavirtfskafslaaqrvgyvvasekfidaynrvrlpfnvsyvsqmfa
    kvaldhreifeertkfiveerermksalremgyritdsrgnfvfvfmekeekerllehlr
    tknvavrsfregvritigkreendmilrelevf