PDB entry 2f8f

View 2f8f on RCSB PDB site
Description: Crystal structure of the Y10F mutant of the gluathione s-transferase from schistosoma haematobium
Class: Transferase
Keywords: thioredoxin fold, homodimer, protein_GTT complex, Transferase
Deposited on 2005-12-02, released 2006-07-04
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-03-21, with a file datestamp of 2012-03-16.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.224
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glutathione s-transferase 28 kda
    Species: SCHISTOSOMA HAEMATOBIUM [TaxId:6185]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P30113
      • engineered (9)
    Domains in SCOPe 2.06: d2f8fa1, d2f8fa2
  • Chain 'B':
    Compound: glutathione s-transferase 28 kda
    Species: SCHISTOSOMA HAEMATOBIUM [TaxId:6185]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P30113
      • engineered (9)
    Domains in SCOPe 2.06: d2f8fb1, d2f8fb2
  • Heterogens: GSH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2f8fA (A:)
    mtgdhikviffngrgraesirmtlvaagvnyederisfqdwpkikptipggrlpavkitd
    nhghvkwmveslaiarymakkhhmmggteeeyynvekligqaedleheyyktlmkpeeek
    qkiikeilngkvpvlldiiceslkastgklavgdkvtladlvliavidhvtdldkefltg
    kypeihkhrenllassprlakylsdraatpf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f8fA (A:)
    dhikviffngrgraesirmtlvaagvnyederisfqdwpkikptipggrlpavkitdnhg
    hvkwmveslaiarymakkhhmmggteeeyynvekligqaedleheyyktlmkpeeekqki
    ikeilngkvpvlldiiceslkastgklavgdkvtladlvliavidhvtdldkefltgkyp
    eihkhrenllassprlakylsdr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2f8fB (B:)
    mtgdhikviffngrgraesirmtlvaagvnyederisfqdwpkikptipggrlpavkitd
    nhghvkwmveslaiarymakkhhmmggteeeyynvekligqaedleheyyktlmkpeeek
    qkiikeilngkvpvlldiiceslkastgklavgdkvtladlvliavidhvtdldkefltg
    kypeihkhrenllassprlakylsdraatpf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f8fB (B:)
    gdhikviffngrgraesirmtlvaagvnyederisfqdwpkikptipggrlpavkitdnh
    ghvkwmveslaiarymakkhhmmggteeeyynvekligqaedleheyyktlmkpeeekqk
    iikeilngkvpvlldiiceslkastgklavgdkvtladlvliavidhvtdldkefltgky
    peihkhrenllassprlakylsd