PDB entry 2f8b

View 2f8b on RCSB PDB site
Description: NMR structure of the C-terminal domain (dimer) of HPV45 oncoprotein E7
Class: oncoprotein, virus/viral protein
Keywords: e7, dimer, hpv, oncoprotein, zinc binding, virus/viral protein complex
Deposited on 2005-12-02, released 2006-08-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein E7
    Species: Human papillomavirus type 45 [TaxId:10593]
    Gene: E7
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21736 (4-55)
      • cloning artifact (0-3)
    Domains in SCOPe 2.08: d2f8ba2, d2f8ba3
  • Chain 'B':
    Compound: Protein E7
    Species: Human papillomavirus type 45 [TaxId:10593]
    Gene: E7
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21736 (4-55)
      • cloning artifact (0-3)
    Domains in SCOPe 2.08: d2f8bb2, d2f8bb3
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2f8bA (A:)
    gshmaepqrhkilcvcckcdgrieltvessaedlrtlqqlflstlsfvcpwcatnq
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2f8bB (B:)
    gshmaepqrhkilcvcckcdgrieltvessaedlrtlqqlflstlsfvcpwcatnq