PDB entry 2f89

View 2f89 on RCSB PDB site
Description: Crystal structure of human FPPS in complex with pamidronate
Class: transferase
Keywords: mevalonate pathway; isoprene biosynthesis; cholesterol biosynthesis; bisphosphonate inhibitor, transferase
Deposited on 2005-12-02, released 2006-02-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'F':
    Compound: Farnesyl Diphosphate Synthase
    Species: Homo sapiens [TaxId:9606]
    Gene: FDPS, FPS, KIAA1293
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2f89f_
  • Heterogens: PO4, MN, 210, HOH

PDB Chain Sequences:

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2f89F (F:)
    gpnsdvyaqekqdfvqhfsqivrvltedemghpeigdaiarlkevleynaiggkynrglt
    vvvafrelveprkqdadslqrawtvgwcvellqafflvaddimdssltrrgqicwyqkpg
    vgldaindanlleaciyrllklycreqpyylnlielflqssyqteigqtldlltapqgnv
    dlvrftekryksivkyktafysfylpiaaamymagidgekehanakkillemgeffqiqd
    dyldlfgdpsvtgkigtdiqdnkcswlvvqclqratpeqyqilkenygqkeaekvarvka
    lyeeldlpavflqyeedsyshimalieqyaaplppavflglarkiykrrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f89F (F:)
    dvyaqekqdfvqhfsqivrvltedemghpeigdaiarlkevleynaiggkynrgltvvva
    frelveprkqdadslqrawtvgwcvellqafflvaddimdssltrrgqicwyqkpgvgld
    aindanlleaciyrllklycreqpyylnlielflqssyqteigqtldlltapqgnvdlvr
    ftekryksivkyktafysfylpiaaamymagidgekehanakkillemgeffqiqddyld
    lfgdpsvtgkigtdiqdnkcswlvvqclqratpeqyqilkenygqkeaekvarvkalyee
    ldlpavflqyeedsyshimalieqyaaplppavflglarkiykrrk