PDB entry 2f84

View 2f84 on RCSB PDB site
Description: Crystal Structure of an orotidine-5'-monophosphate decarboxylase homolog from P.falciparum
Class: lyase
Keywords: orotidine, OMP, decarboxylase, Structural Genomics, PSI, Protein Structure Initiative, Structural Genomics of Pathogenic Protozoa Consortium, SGPP, LYASE
Deposited on 2005-12-01, released 2005-12-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.23
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: orotidine monophosphate decarboxylase
    Species: PLASMODIUM FALCIPARUM [TaxId:36329]
    Gene: NC_004314
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2f84a1
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2f84A (A:)
    mgfkvklekrrnaintclcigldpdekdienfmknekennynnikknlkekyinnvsikk
    dillkapdniireekseeffyffnhfcfyiinetnkyaltfkmnfafyipygsvgidvlk
    nvfdylyelniptildmkindigntvknyrkfifeylksdsctvniymgtnmlkdicyde
    eknkyysafvlvkttnpdsaifqknlsldnkqayvimaqealnmssylnleqnnefigfv
    vgansydemnyirtyfpncyilspgigaqngdlhktltngyhksyekilinigraitknp
    ypqkaaqmyydqinailkqnmes