PDB entry 2f7y

View 2f7y on RCSB PDB site
Description: Crystal structure of Molybdenum cofactor biosynthesis protein Mog from Shewanella oneidensis
Class: structural genomics, unknown function
Keywords: Structural Genomics, Molybdenum cofactor biosynthesis protein Mog , PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG
Deposited on 2005-12-01, released 2006-01-17
The last revision prior to the SCOP 1.73 freeze date was dated 2006-01-17, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.194
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: molybdenum cofactor biosynthesis protein Mog
    Species: Shewanella oneidensis
    Database cross-references and differences (RAF-indexed):
    • GB NP_715707
      • modified residue (60)
      • modified residue (94-95)
      • modified residue (102)
      • modified residue (156)
    Domains in SCOP 1.73: d2f7ya1
  • Chain 'B':
    Compound: molybdenum cofactor biosynthesis protein Mog
    Species: Shewanella oneidensis
    Database cross-references and differences (RAF-indexed):
    • GB NP_715707
      • modified residue (60)
      • modified residue (94-95)
      • modified residue (102)
      • modified residue (156)
    Domains in SCOP 1.73: d2f7yb1
  • Chain 'C':
    Compound: molybdenum cofactor biosynthesis protein Mog
    Species: Shewanella oneidensis
    Database cross-references and differences (RAF-indexed):
    • GB NP_715707
      • modified residue (60)
      • modified residue (94-95)
      • modified residue (102)
      • modified residue (156)
    Domains in SCOP 1.73: d2f7yc1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2f7yA (A:)
    mskakigivtvsdrasagiyedisgkaiidtlndyltsewepiyqvipdeqdviettlik
    madeqdcclivttggtgpakrdvtpeateavcdrmmpgfgelmraeslkfvptailsrqt
    aglrgdslivnlpgkpksirecldavfpaipycidlmegpylecneavikpfrpkak
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f7yA (A:)
    kakigivtvsdrasagiyedisgkaiidtlndyltsewepiyqvipdeqdviettlikma
    deqdcclivttggtgpakrdvtpeateavcdrmmpgfgelmraeslkfvptailsrqtag
    lrgdslivnlpgkpksirecldavfpaipycidlmegpylecneavikpfrpk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2f7yB (B:)
    mskakigivtvsdrasagiyedisgkaiidtlndyltsewepiyqvipdeqdviettlik
    madeqdcclivttggtgpakrdvtpeateavcdrmmpgfgelmraeslkfvptailsrqt
    aglrgdslivnlpgkpksirecldavfpaipycidlmegpylecneavikpfrpkak
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f7yB (B:)
    kigivtvsdragiyedisgkaiidtlndyltsewepiyqvipdeqdviettlikmadeqd
    cclivttggtgpakrdvtpeateavcdrmmpgfgelmraeslkfvptailsrqtaglrgd
    slivnlpgkpksirecldavfpaipycidlmegpylecneavikpfrp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2f7yC (C:)
    mskakigivtvsdrasagiyedisgkaiidtlndyltsewepiyqvipdeqdviettlik
    madeqdcclivttggtgpakrdvtpeateavcdrmmpgfgelmraeslkfvptailsrqt
    aglrgdslivnlpgkpksirecldavfpaipycidlmegpylecneavikpfrpkak
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f7yC (C:)
    akigivtvsdrasagiyedisgkaiidtlndyltsewepiyqvipdeqdviettlikmad
    eqdcclivttggtgpakrdvtpeateavcdrmmpgfgelmraeslkfvptailsrqtagl
    rgdslivnlpgkpksirecldavfpaipycidlmegpylecneavikpfrp