PDB entry 2f7x

View 2f7x on RCSB PDB site
Description: Protein Kinase A bound to (S)-2-(1H-Indol-3-yl)-1-[5-((E)-2-pyridin-4-yl-vinyl)-pyridin-3-yloxymethyl]-ethylamine
Class: transferase
Keywords: Protein Kinase A, AKT inhibitors
Deposited on 2005-12-01, released 2006-06-27
The last revision prior to the SCOP 1.73 freeze date was dated 2006-07-04, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.268
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'E':
    Compound: cAMP-dependent protein kinase, alpha-catalytic subunit
    Species: BOS TAURUS
    Gene: PRKACA
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2f7xe1
  • Chain 'I':
    Compound: PKI, inhibitory peptide
  • Heterogens: 4EA, HOH

PDB Chain Sequences:

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2f7xE (E:)
    mgnaaaakkgseqesvkeflakakedflkkwenpaqntahldqferiktlgtgsfgrvml
    vkhmetgnhyamkildkqkvvklkqiehtlnekrilqavnfpflvklefsfkdnsnlymv
    meyvpggemfshlrrigrfsepharfyaaqivltfeylhsldliyrdlkpenllidqqgy
    iqvtdfgfakrvkgrtwtlcgtpeylapeiilskgynkavdwwalgvliyemaagyppff
    adqpiqiyekivsgkvrfpshfssdlkdllrnllqvdltkrfgnlkngvndiknhkwfat
    tdwiaiyqrkveapfipkfkgpgdtsnfddyeeeeirvsinekcgkefsef
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f7xE (E:)
    vkeflakakedflkkwenpaqntahldqferiktlgtgsfgrvmlvkhmetgnhyamkil
    dkqkvvklkqiehtlnekrilqavnfpflvklefsfkdnsnlymvmeyvpggemfshlrr
    igrfsepharfyaaqivltfeylhsldliyrdlkpenllidqqgyiqvtdfgfakrvkgr
    twtlcgtpeylapeiilskgynkavdwwalgvliyemaagyppffadqpiqiyekivsgk
    vrfpshfssdlkdllrnllqvdltkrfgnlkngvndiknhkwfattdwiaiyqrkveapf
    ipkfkgpgdtsnfddyeeeeirvsinekcgkefsef
    

  • Chain 'I':
    No sequence available.