PDB entry 2f7s

View 2f7s on RCSB PDB site
Description: The crystal structure of human Rab27b bound to GDP
Class: signaling protein
Keywords: Rab27b, G-protein, Rab, Structural Genomics, Structural Genomics Consortium, SGC
Deposited on 2005-12-01, released 2005-12-20
The last revision prior to the SCOP 1.73 freeze date was dated 2006-10-10, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.248
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ras-related protein Rab-27B
    Species: HOMO SAPIENS
    Gene: RAB27B
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2f7sa1
  • Chain 'B':
    Compound: Ras-related protein Rab-27B
    Species: HOMO SAPIENS
    Gene: RAB27B
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2f7sb1
  • Heterogens: MG, GDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2f7sA (A:)
    mgsshhhhhhssglvprgsgdydylikllalgdsgvgkttflyrytdnkfnpkfittvgi
    dfrekrvvynaqgpngssgkafkvhlqlwdtagqerfrslttaffrdamgfllmfdltsq
    qsflnvrnwmsqlqanaycenpdivlignkadlpdqrevnerqareladkygipyfetsa
    atgqnvekavetlldlimkrmeqcvektqipdtvngg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f7sA (A:)
    dydylikllalgdsgvgkttflyrytdnkfnpkfittvgidfrekrvvynagkafkvhlq
    lwdtagqerfrslttaffrdamgfllmfdltsqqsflnvrnwmsqlqanaycenpdivli
    gnkadlpdqrevnerqareladkygipyfetsaatgqnvekavetlldlimkrmeqcve
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2f7sB (B:)
    mgsshhhhhhssglvprgsgdydylikllalgdsgvgkttflyrytdnkfnpkfittvgi
    dfrekrvvynaqgpngssgkafkvhlqlwdtagqerfrslttaffrdamgfllmfdltsq
    qsflnvrnwmsqlqanaycenpdivlignkadlpdqrevnerqareladkygipyfetsa
    atgqnvekavetlldlimkrmeqcvektqipdtvngg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f7sB (B:)
    ydylikllalgdsgvgkttflyrytdnkfnpkfittvgidfrekrvvynakafkvhlqlw
    dtagqerfrslttaffrdamgfllmfdltsqqsflnvrnwmsqlqanaycenpdivlign
    kadlpdqrevnerqareladkygipyfetsaatgqnvekavetlldlimkrmeqcv