PDB entry 2f7e

View 2f7e on RCSB PDB site
Description: PKA complexed with (S)-2-(1H-Indol-3-yl)-1-(5-isoquinolin-6-yl-pyridin-3-yloxymethyl-etylamine
Class: transferase
Keywords: Protein Kinase A, AKT inhibitors
Deposited on 2005-11-30, released 2006-06-27
The last revision prior to the SCOP 1.73 freeze date was dated 2006-12-05, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.1
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'E':
    Compound: cAMP-dependent protein kinase, alpha-catalytic subunit
    Species: BOS TAURUS
    Gene: PRKACA
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2f7ee1
  • Chain 'I':
    Compound: PKI inhibitory peptide
  • Heterogens: 2EA, HOH

PDB Chain Sequences:

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2f7eE (E:)
    mgnaaaakkgseqesvkeflakakedflkkwenpaqntahldqferiktlgtgsfgrvml
    vkhmetgnhyamkildkqkvvklkqiehtlnekrilqavnfpflvklefsfkdnsnlymv
    meyvpggemfshlrrigrfsepharfyaaqivltfeylhsldliyrdlkpenllidqqgy
    iqvtdfgfakrvkgrtwtlcgtpeylapeiilskgynkavdwwalgvliyemaagyppff
    adqpiqiyekivsgkvrfpshfssdlkdllrnllqvdltkrfgnlkngvndiknhkwfat
    tdwiaiyqrkveapfipkfkgpgdtsnfddyeeeeirvsinekcgkefsef
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f7eE (E:)
    vkeflakakedflkkwenpaqntahldqferiktlgtgsfgrvmlvkhmetgnhyamkil
    dkqkvvklkqiehtlnekrilqavnfpflvklefsfkdnsnlymvmeyvpggemfshlrr
    igrfsepharfyaaqivltfeylhsldliyrdlkpenllidqqgyiqvtdfgfakrvkgr
    twtlcgtpeylapeiilskgynkavdwwalgvliyemaagyppffadqpiqiyekivsgk
    vrfpshfssdlkdllrnllqvdltkrfgnlkngvndiknhkwfattdwiaiyqrkveapf
    ipkfkgpgdtsnfddyeeeeirvsinekcgkefsef
    

  • Chain 'I':
    No sequence available.