PDB entry 2f76

View 2f76 on RCSB PDB site
Description: Solution structure of the M-PMV wild type matrix protein (p10)
Class: viral protein
Keywords: 4 alpha-helices, VIRAL PROTEIN
Deposited on 2005-11-30, released 2006-12-05
The last revision prior to the SCOPe 2.08 freeze date was dated 2010-08-11, with a file datestamp of 2010-08-06.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Compound: Core protein p10
    Species: Simian retrovirus 1 [TaxId:11942]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04022 (1-99)
      • insertion (0)
    Domains in SCOPe 2.08: d2f76x_

PDB Chain Sequences:

  • Chain 'X':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2f76X (X:)
    mgqelsqheryveqlkqalktrgvkvkyadllkffdfvkdtcpwfpqegtidikrwrrvg
    dcfqdyyntfgpekvpvtafsywnlikelidkkevnpqvm