PDB entry 2f73

View 2f73 on RCSB PDB site
Description: Crystal structure of human fatty acid binding protein 1 (FABP1)
Class: lipid binding protein
Keywords: fatty acid binding protein, Structural Genomics, Structural Genomics Consortium, SGC
Deposited on 2005-11-30, released 2005-12-13
The last revision prior to the SCOP 1.73 freeze date was dated 2005-12-13, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.25
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fatty acid-binding protein, liver
    Species: HOMO SAPIENS
    Gene: FABP1, FABPL
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07148 (22-148)
      • cloning artifact (14-21)
    Domains in SCOP 1.73: d2f73a1
  • Chain 'B':
    Compound: Fatty acid-binding protein, liver
    Species: HOMO SAPIENS
    Gene: FABP1, FABPL
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07148 (22-148)
      • cloning artifact (13-21)
    Domains in SCOP 1.73: d2f73b1
  • Chain 'C':
    Compound: Fatty acid-binding protein, liver
    Species: HOMO SAPIENS
    Gene: FABP1, FABPL
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07148 (22-148)
      • cloning artifact (14-21)
    Domains in SCOP 1.73: d2f73c1
  • Chain 'D':
    Compound: Fatty acid-binding protein, liver
    Species: HOMO SAPIENS
    Gene: FABP1, FABPL
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07148 (22-148)
      • cloning artifact (14-21)
    Domains in SCOP 1.73: d2f73d1
  • Chain 'E':
    Compound: Fatty acid-binding protein, liver
    Species: HOMO SAPIENS
    Gene: FABP1, FABPL
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07148 (22-148)
      • cloning artifact (14-21)
    Domains in SCOP 1.73: d2f73e1
  • Chain 'F':
    Compound: Fatty acid-binding protein, liver
    Species: HOMO SAPIENS
    Gene: FABP1, FABPL
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07148 (22-148)
      • cloning artifact (14-21)
    Domains in SCOP 1.73: d2f73f1
  • Chain 'G':
    Compound: Fatty acid-binding protein, liver
    Species: HOMO SAPIENS
    Gene: FABP1, FABPL
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07148 (22-148)
      • cloning artifact (13-21)
    Domains in SCOP 1.73: d2f73g1
  • Chain 'H':
    Compound: Fatty acid-binding protein, liver
    Species: HOMO SAPIENS
    Gene: FABP1, FABPL
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07148 (22-148)
      • cloning artifact (14-21)
    Domains in SCOP 1.73: d2f73h1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2f73A (A:)
    mhhhhhhssgvdlgtenlyfqsmsfsgkyqlqsqenfeafmkaiglpeeliqkgkdikgv
    seivqngkhfkftitagskviqneftvgeeceletmtgekvktvvqlegdnklvttfkni
    ksvtelngdiitntmtlgdivfkriskri
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f73A (A:)
    tenlyfqsmsfsgkyqlqsqenfeafmkaiglpeeliqkgkdikgvseivqngkhfkfti
    tagskviqneftvgeeceletmtgekvktvvqlegdnklvttfkniksvtelngdiitnt
    mtlgdivfkriskri
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2f73B (B:)
    mhhhhhhssgvdlgtenlyfqsmsfsgkyqlqsqenfeafmkaiglpeeliqkgkdikgv
    seivqngkhfkftitagskviqneftvgeeceletmtgekvktvvqlegdnklvttfkni
    ksvtelngdiitntmtlgdivfkriskri
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f73B (B:)
    gtenlyfqsmsfsgkyqlqsqenfeafmkaiglpeeliqkgkdikgvseivqngkhfkft
    itagskviqneftvgeeceletmtgekvktvvqlegdnklvttfkniksvtelngdiitn
    tmtlgdivfkriskri
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2f73C (C:)
    mhhhhhhssgvdlgtenlyfqsmsfsgkyqlqsqenfeafmkaiglpeeliqkgkdikgv
    seivqngkhfkftitagskviqneftvgeeceletmtgekvktvvqlegdnklvttfkni
    ksvtelngdiitntmtlgdivfkriskri
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f73C (C:)
    tenlyfqsmsfsgkyqlqsqenfeafmkaiglpeeliqkgkdikgvseivqngkhfkfti
    tagskviqneftvgeeceletmtgekvktvvqlegdnklvttfkniksvtelngdiitnt
    mtlgdivfkriskri
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2f73D (D:)
    mhhhhhhssgvdlgtenlyfqsmsfsgkyqlqsqenfeafmkaiglpeeliqkgkdikgv
    seivqngkhfkftitagskviqneftvgeeceletmtgekvktvvqlegdnklvttfkni
    ksvtelngdiitntmtlgdivfkriskri
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f73D (D:)
    tenlyfqsmsfsgkyqlqsqenfeafmkaiglpeeliqkgkdikgvseivqngkhfkfti
    tagskviqneftvgeeceletmtgekvktvvqlegdnklvttfkniksvtelngdiitnt
    mtlgdivfkriskri
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2f73E (E:)
    mhhhhhhssgvdlgtenlyfqsmsfsgkyqlqsqenfeafmkaiglpeeliqkgkdikgv
    seivqngkhfkftitagskviqneftvgeeceletmtgekvktvvqlegdnklvttfkni
    ksvtelngdiitntmtlgdivfkriskri
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f73E (E:)
    tenlyfqsmsfsgkyqlqsqenfeafmkaiglpeeliqkgkdikgvseivqngkhfkfti
    tagskviqneftvgeeceletmtgekvktvvqlegdnklvttfkniksvtelngdiitnt
    mtlgdivfkriskri
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2f73F (F:)
    mhhhhhhssgvdlgtenlyfqsmsfsgkyqlqsqenfeafmkaiglpeeliqkgkdikgv
    seivqngkhfkftitagskviqneftvgeeceletmtgekvktvvqlegdnklvttfkni
    ksvtelngdiitntmtlgdivfkriskri
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f73F (F:)
    tenlyfqsmsfsgkyqlqsqenfeafmkaiglpeeliqkgkdikgvseivqngkhfkfti
    tagskviqneftvgeeceletmtgekvktvvqlegdnklvttfkniksvtelngdiitnt
    mtlgdivfkriskri
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2f73G (G:)
    mhhhhhhssgvdlgtenlyfqsmsfsgkyqlqsqenfeafmkaiglpeeliqkgkdikgv
    seivqngkhfkftitagskviqneftvgeeceletmtgekvktvvqlegdnklvttfkni
    ksvtelngdiitntmtlgdivfkriskri
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f73G (G:)
    gtenlyfqsmsfsgkyqlqsqenfeafmkaiglpeeliqkgkdikgvseivqngkhfkft
    itagskviqneftvgeeceletmtgekvktvvqlegdnklvttfkniksvtelngdiitn
    tmtlgdivfkriskri
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2f73H (H:)
    mhhhhhhssgvdlgtenlyfqsmsfsgkyqlqsqenfeafmkaiglpeeliqkgkdikgv
    seivqngkhfkftitagskviqneftvgeeceletmtgekvktvvqlegdnklvttfkni
    ksvtelngdiitntmtlgdivfkriskri
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f73H (H:)
    tenlyfqsmsfsgkyqlqsqenfeafmkaiglpeeliqkgkdikgvseivqngkhfkfti
    tagskviqneftvgeeceletmtgekvktvvqlegdnklvttfkniksvtelngdiitnt
    mtlgdivfkriskri