PDB entry 2f6q

View 2f6q on RCSB PDB site
Description: The crystal structure of human peroxisomal delta3, delta2 enoyl CoA isomerase (PECI)
Class: isomerase
Keywords: enoyl CoA isomerase, peroxisomes, fatty acid metabolism, Structural Genomics, Structural Genomics Consortium, SGC, ISOMERASE
Deposited on 2005-11-29, released 2005-12-20
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.215
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peroxisomal 3,2-trans-enoyl-CoA isomerase
    Species: Homo sapiens [TaxId:9606]
    Gene: PECI
    Database cross-references and differences (RAF-indexed):
    • Uniprot O75521 (23-End)
      • cloning artifact (16-22)
      • modified residue (39)
      • modified residue (53)
      • modified residue (58)
      • modified residue (176)
      • modified residue (184)
    Domains in SCOPe 2.05: d2f6qa1
  • Chain 'B':
    Compound: Peroxisomal 3,2-trans-enoyl-CoA isomerase
    Species: Homo sapiens [TaxId:9606]
    Gene: PECI
    Database cross-references and differences (RAF-indexed):
    • Uniprot O75521
      • modified residue (39)
      • modified residue (53)
      • modified residue (58)
      • modified residue (176)
      • modified residue (184)
    Domains in SCOPe 2.05: d2f6qb_
  • Chain 'C':
    Compound: Peroxisomal 3,2-trans-enoyl-CoA isomerase
    Species: Homo sapiens [TaxId:9606]
    Gene: PECI
    Database cross-references and differences (RAF-indexed):
    • Uniprot O75521 (23-End)
      • modified residue (39)
      • modified residue (53)
      • modified residue (58)
      • modified residue (176)
      • modified residue (184)
    Domains in SCOPe 2.05: d2f6qc_
  • Heterogens: TRS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2f6qA (A:)
    mhhhhhhssgvdlgtenlyfqsmgfetlvvtsedgitkimfnrpkkknaintemyheimr
    alkaaskddsiitvltgngdyyssgndltnftdippggveekaknnavllrefvgcfidf
    pkpliavvngpavgisvtllglfdavyasdratfhtpfshlgqspegcssytfpkimspa
    katemlifgkkltageacaqglvtevfpdstfqkevwtrlkafaklppnalriskevirk
    rereklhavnaeecnvlqgrwlsdectnavvnflsrkskl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f6qA (A:)
    nlyfqsmgfetlvvtsedgitkimfnrpkkknaintemyheimralkaaskddsiitvlt
    gngdyyssgndldippggveekaknnavllrefvgcfidfpkpliavvngpavgisvtll
    glfdavyasdratfhtpfshlgqspegcssytfpkimspakatemlifgkkltageacaq
    glvtevfpdstfqkevwtrlkafaklppnalriskevirkrereklhavnaeecnvlqgr
    wlsdectn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2f6qB (B:)
    mhhhhhhssgvdlgtenlyfqsmgfetlvvtsedgitkimfnrpkkknaintemyheimr
    alkaaskddsiitvltgngdyyssgndltnftdippggveekaknnavllrefvgcfidf
    pkpliavvngpavgisvtllglfdavyasdratfhtpfshlgqspegcssytfpkimspa
    katemlifgkkltageacaqglvtevfpdstfqkevwtrlkafaklppnalriskevirk
    rereklhavnaeecnvlqgrwlsdectnavvnflsrkskl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f6qB (B:)
    fetlvvtsedgitkimfnrpkkknaintemyheimralkaaskddsiitvltgngdyyss
    gndltnftdippggveekaknnavllrefvgcfidfpkpliavvngpavgisvtllglfd
    avyasdratfhtpfshlgqspegcssytfpkimspakatemlifgkkltageacaqglvt
    evfpdstfqkevwtrlkafaklppnalriskevirkrereklhavnaeecnvlqgrwlsd
    ectnavvnflsr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2f6qC (C:)
    mhhhhhhssgvdlgtenlyfqsmgfetlvvtsedgitkimfnrpkkknaintemyheimr
    alkaaskddsiitvltgngdyyssgndltnftdippggveekaknnavllrefvgcfidf
    pkpliavvngpavgisvtllglfdavyasdratfhtpfshlgqspegcssytfpkimspa
    katemlifgkkltageacaqglvtevfpdstfqkevwtrlkafaklppnalriskevirk
    rereklhavnaeecnvlqgrwlsdectnavvnflsrkskl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f6qC (C:)
    gfetlvvtsedgitkimfnrpkkknaintemyheimralkaaskddsiitvltgngdyys
    sgndltveekaknnavllrefvgcfidfpkpliavvngpavgisvtllglfdavyasdra
    tfhtpfshlgqspegcssytfpkimspakatemlifgkkltageacaqglvtevfpdstf
    qkevwtrlkafaklppnalriskevirkrereklhavnaeecnvlqgrwlsdectnavvn
    f