PDB entry 2f6l

View 2f6l on RCSB PDB site
Description: X-ray structure of Chorismate Mutase from Mycobacterium Tuberculosis
Class: isomerase
Keywords: helical, dimer, ISOMERASE
Deposited on 2005-11-29, released 2005-12-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: chorismate mutase
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: Rv1885c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2f6la1
  • Chain 'B':
    Compound: chorismate mutase
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: Rv1885c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2f6lb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2f6lA (A:)
    dgtsqlaelvdaaaerlevadpvaafkwraqlpiedsgrveqqlaklgedarsqhidpdy
    vtrvfddqirateaieysrfsdwklnpasappeppdlsasrsaidslnnrmlsqiwshws
    llsapscaaqldrakrdivrsrhldslyqralttatqsycqalppa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2f6lB (B:)
    dgtsqlaelvdaaaerlevadpvaafkwraqlpiedsgrveqqlaklgedarsqhidpdy
    vtrvfddqirateaieysrfsdwklnpasappeppdlsasrsaidslnnrmlsqiwshws
    llsapscaaqldrakrdivrsrhldslyqralttatqsycqalppa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f6lB (B:)
    tsqlaelvdaaaerlevadpvaafkwraqlpiedsgrveqqlaklgedarsqhidpdyvt
    rvfddqirateaieysrfsdwklnpasappeppdlsasrsaidslnnrmlsqiwshwsll
    sapscaaqldrakrdivrsrhldslyqralttatqsycqalppa