PDB entry 2f6k

View 2f6k on RCSB PDB site
Description: Crystal Structure of Amidohydrorolase II; Northeast Structural Genomics Target LpR24
Class: lyase
Keywords: Metal Dependent Hydrolyse, Aminohydro_2, ACMDS, ACMS, Tryptophan-NDA metabolism, quinolinic acid, QUIN, nitrobenzoic acid biodegradation, Structural Genomics, PSI, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, LYASE
Deposited on 2005-11-29, released 2006-01-10
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.192
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: metal-dependent hydrolase
    Species: Lactobacillus plantarum [TaxId:220668]
    Database cross-references and differences (RAF-indexed):
    • GB NP_786293 (Start-306)
      • modified residue (43)
      • modified residue (177)
      • modified residue (181)
      • modified residue (186)
      • modified residue (232)
      • modified residue (252)
    Domains in SCOPe 2.05: d2f6ka1
  • Chain 'B':
    Compound: metal-dependent hydrolase
    Species: Lactobacillus plantarum [TaxId:220668]
    Database cross-references and differences (RAF-indexed):
    • GB NP_786293 (Start-306)
      • modified residue (43)
      • modified residue (177)
      • modified residue (181)
      • modified residue (186)
      • modified residue (232)
      • modified residue (252)
    Domains in SCOPe 2.05: d2f6kb_
  • Heterogens: MN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2f6kA (A:)
    mskidfhthylptsyvealkrhvpgdpdgwptpewtpqltlnfmrdndisysilslssph
    vnfgdkaetirlveaanddgkslaqqypdqlgylaslpipyeldavktvqqaldqdgalg
    vtvptnsrglyfgspvlervyqeldarqaivalhpnepailpknvdidlpvpllgffmdt
    tmtfinmlkyhffekypnikviiphagaflgivddriaqyaqkvyqvdvydvmhhvyfdv
    agavlprqlptlmslaqpehllygsdipytpldgsrqlghalattdlltneqkqaifydn
    ahrllte
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f6kA (A:)
    skidfhthylptsyvealkrhvpgdpdgwptpewtpqltlnfmrdndisysilslssphv
    nfgdkaetirlveaanddgkslaqqypdqlgylaslpipyeldavktvqqaldqdgalgv
    tvptnsrglyfgspvlervyqeldarqaivalhpnepailpknvdidlpvpllgffmdtt
    mtfinmlkyhffekypnikviiphagaflgivddriaqyaqkvyqvdvydvmhhvyfdva
    gavlprqlptlmslaqpehllygsdipytpldgsrqlghalattdlltneqkqaifydna
    hrllte
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2f6kB (B:)
    mskidfhthylptsyvealkrhvpgdpdgwptpewtpqltlnfmrdndisysilslssph
    vnfgdkaetirlveaanddgkslaqqypdqlgylaslpipyeldavktvqqaldqdgalg
    vtvptnsrglyfgspvlervyqeldarqaivalhpnepailpknvdidlpvpllgffmdt
    tmtfinmlkyhffekypnikviiphagaflgivddriaqyaqkvyqvdvydvmhhvyfdv
    agavlprqlptlmslaqpehllygsdipytpldgsrqlghalattdlltneqkqaifydn
    ahrllte
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f6kB (B:)
    skidfhthylptsyvealkrhvpgdpdgwptpewtpqltlnfmrdndisysilslssphv
    nfgdkaetirlveaanddgkslaqqypdqlgylaslpipyeldavktvqqaldqdgalgv
    tvptnsrglyfgspvlervyqeldarqaivalhpnepailpknvdidlpvpllgffmdtt
    mtfinmlkyhffekypnikviiphagaflgivddriaqyaqkvyqvdvydvmhhvyfdva
    gavlprqlptlmslaqpehllygsdipytpldgsrqlghalattdlltneqkqaifydna
    hrllte