PDB entry 2f6i

View 2f6i on RCSB PDB site
Description: Crystal structure of the ClpP protease catalytic domain from Plasmodium falciparum
Class: Hydrolase
Keywords: Clp protease, structural genomics, Structural Genomics Consortium, SGC, Hydrolase
Deposited on 2005-11-29, released 2005-12-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-06-15, with a file datestamp of 2011-06-10.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: 0.21
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ATP-dependent CLP protease, putative
    Species: Plasmodium falciparum [TaxId:5833]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O97252 (23-End)
      • cloning artifact (21-22)
    Domains in SCOPe 2.08: d2f6ia1, d2f6ia2
  • Chain 'B':
    Compound: ATP-dependent CLP protease, putative
    Species: Plasmodium falciparum [TaxId:5833]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O97252 (23-End)
      • cloning artifact (21-22)
    Domains in SCOPe 2.08: d2f6ib2, d2f6ib3
  • Chain 'C':
    Compound: ATP-dependent CLP protease, putative
    Species: Plasmodium falciparum [TaxId:5833]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O97252 (23-End)
      • cloning artifact (21-22)
    Domains in SCOPe 2.08: d2f6ic2, d2f6ic3
  • Chain 'D':
    Compound: ATP-dependent CLP protease, putative
    Species: Plasmodium falciparum [TaxId:5833]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O97252 (23-End)
      • cloning artifact (21-22)
    Domains in SCOPe 2.08: d2f6id2, d2f6id3
  • Chain 'E':
    Compound: ATP-dependent CLP protease, putative
    Species: Plasmodium falciparum [TaxId:5833]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O97252 (23-End)
      • cloning artifact (21-22)
    Domains in SCOPe 2.08: d2f6ie2, d2f6ie3
  • Chain 'F':
    Compound: ATP-dependent CLP protease, putative
    Species: Plasmodium falciparum [TaxId:5833]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O97252 (23-End)
      • cloning artifact (21-22)
    Domains in SCOPe 2.08: d2f6if2, d2f6if3
  • Chain 'G':
    Compound: ATP-dependent CLP protease, putative
    Species: Plasmodium falciparum [TaxId:5833]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O97252 (23-End)
      • cloning artifact (21-22)
    Domains in SCOPe 2.08: d2f6ig2, d2f6ig3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2f6iA (A:)
    mgsshhhhhhssgrenlyfqghmdikdmkkdvklfffkkriiyltdeinkktadelisql
    lyldninhndikiyinspggsineglaildifnyiksdiqtisfglvasmasvilasgkk
    gkrkslpncrimihqplgnafghpqdieiqtkeilylkkllyhylssftnqtvetiekds
    drdyymnaleakqygiidevietklphpyfnkvek
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f6iA (A:)
    hmdikdmkkdvklfffkkriiyltdeinkktadelisqllyldninhndikiyinspggs
    ineglaildifnyiksdiqtisfglvasmasvilasgkkgkrkslpncrimihqplgnaf
    qtkeilylkkllyhylssftnqtvetiekdsdrdyymnaleakqygiidevietklphpy
    fn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2f6iB (B:)
    mgsshhhhhhssgrenlyfqghmdikdmkkdvklfffkkriiyltdeinkktadelisql
    lyldninhndikiyinspggsineglaildifnyiksdiqtisfglvasmasvilasgkk
    gkrkslpncrimihqplgnafghpqdieiqtkeilylkkllyhylssftnqtvetiekds
    drdyymnaleakqygiidevietklphpyfnkvek
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f6iB (B:)
    hmdikdmkkdvklfffkkriiyltdeinkktadelisqllyldninhndikiyinspggs
    ineglaildifnyiksdiqtisfglvasmasvilasgkkgkrkslpncrimihqtkeily
    lkkllyhylssftnqtvetiekdsdrdyymnaleakqygiidevietklphpyf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2f6iC (C:)
    mgsshhhhhhssgrenlyfqghmdikdmkkdvklfffkkriiyltdeinkktadelisql
    lyldninhndikiyinspggsineglaildifnyiksdiqtisfglvasmasvilasgkk
    gkrkslpncrimihqplgnafghpqdieiqtkeilylkkllyhylssftnqtvetiekds
    drdyymnaleakqygiidevietklphpyfnkvek
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f6iC (C:)
    hmdikdmkkdvklfffkkriiyltdeinkktadelisqllyldninhndikiyinspggs
    ineglaildifnyiksdiqtisfglvasmasvilasgkkgkrkslpncrimihqplgnaf
    giqtkeilylkkllyhylssftnqtvetiekdsdrdyymnaleakqygiidevietklph
    pyf
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2f6iD (D:)
    mgsshhhhhhssgrenlyfqghmdikdmkkdvklfffkkriiyltdeinkktadelisql
    lyldninhndikiyinspggsineglaildifnyiksdiqtisfglvasmasvilasgkk
    gkrkslpncrimihqplgnafghpqdieiqtkeilylkkllyhylssftnqtvetiekds
    drdyymnaleakqygiidevietklphpyfnkvek
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f6iD (D:)
    hmdikdmkkdvklfffkkriiyltdeinkktadelisqllyldninhndikiyinspggs
    ineglaildifnyiksdiqtisfglvasmasvilasgkkgkrkslpncrimihqplgnaf
    iqtkeilylkkllyhylssftnqtvetiekdsdrdyymnaleakqygiidevietklphp
    yf
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2f6iE (E:)
    mgsshhhhhhssgrenlyfqghmdikdmkkdvklfffkkriiyltdeinkktadelisql
    lyldninhndikiyinspggsineglaildifnyiksdiqtisfglvasmasvilasgkk
    gkrkslpncrimihqplgnafghpqdieiqtkeilylkkllyhylssftnqtvetiekds
    drdyymnaleakqygiidevietklphpyfnkvek
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f6iE (E:)
    hmdikdmkkdvklfffkkriiyltdeinkktadelisqllyldninhndikiyinspggs
    ineglaildifnyiksdiqtisfglvasmasvilasgkkgkrkslpncrimihiqtkeil
    ylkkllyhylssftnqtvetiekdsdrdyymnaleakqygiidevietklphpyf
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2f6iF (F:)
    mgsshhhhhhssgrenlyfqghmdikdmkkdvklfffkkriiyltdeinkktadelisql
    lyldninhndikiyinspggsineglaildifnyiksdiqtisfglvasmasvilasgkk
    gkrkslpncrimihqplgnafghpqdieiqtkeilylkkllyhylssftnqtvetiekds
    drdyymnaleakqygiidevietklphpyfnkvek
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f6iF (F:)
    hmdikdmkkdvklfffkkriiyltdeinkktadelisqllyldninhndikiyinspggs
    ineglaildifnyiksdiqtisfglvasmasvilasgkkgkrkslpncrimihqplgnaf
    qtkeilylkkllyhylssftnqtvetiekdsdrdyymnaleakqygiidevietklphpy
    f
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2f6iG (G:)
    mgsshhhhhhssgrenlyfqghmdikdmkkdvklfffkkriiyltdeinkktadelisql
    lyldninhndikiyinspggsineglaildifnyiksdiqtisfglvasmasvilasgkk
    gkrkslpncrimihqplgnafghpqdieiqtkeilylkkllyhylssftnqtvetiekds
    drdyymnaleakqygiidevietklphpyfnkvek
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f6iG (G:)
    hmdikdmkkdvklfffkkriiyltdeinkktadelisqllyldninhndikiyinspggs
    ineglaildifnyiksdiqtisfglvasmasvilasgkkgkrkslpncrimihqpiqtke
    ilylkkllyhylssftnqtvetiekdsdrdyymnaleakqygiidevietklphpyfn