PDB entry 2f6f

View 2f6f on RCSB PDB site
Description: The structure of the S295F mutant of human PTP1B
Class: hydrolase
Keywords: Phosphatase, ligand binding, mutations, HYDROLASE
Deposited on 2005-11-29, released 2005-12-06
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.186
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosine-protein phosphatase, non-receptor type 1
    Species: Homo sapiens [TaxId:9606]
    Gene: PTPN1, PTP1B
    Database cross-references and differences (RAF-indexed):
    • Uniprot P18031 (4-301)
      • cloning artifact (0-3)
      • engineered (298)
    Domains in SCOPe 2.03: d2f6fa_
  • Heterogens: CL, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2f6fA (A:)
    alefmemekefeqidksgswaaiyqdirheasdfpcrvaklpknknrnryrdvspfdhsr
    iklhqedndyinaslikmeeaqrsyiltqgplpntcghfwemvweqksrgvvmlnrvmek
    gslkcaqywpqkeekemifedtnlkltlisediksyytvrqlelenlttqetreilhfhy
    ttwpdfgvpespasflnflfkvresgslspehgpvvvhcsagigrsgtfcladtclllmd
    krkdpssvdikkvllemrkfrmgliqtadqlrfsylaviegakfimgdssvqdqwkelfh
    ed