PDB entry 2f6c

View 2f6c on RCSB PDB site
Description: Reaction geometry and thermostability of pyranose 2-oxidase from the white-rot fungus Peniophora sp., Thermostability mutant E542K
Class: oxidoreductase
Keywords: Flavoprotein, covalent, histidine-bound, lignin degradation, thermostability mutation, D2 tetramer, PHBH fold, GMC oxidoreductase, glutathione-reductase related fold, OXIDOREDUCTASE
Deposited on 2005-11-29, released 2006-06-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 1.84 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pyranose 2-oxidase
    Species: Peniophora sp. SG [TaxId:204723]
    Gene: p2ox, poxSG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8J136
      • engineered (513)
    Domains in SCOPe 2.07: d2f6ca1, d2f6ca2
  • Heterogens: FAD, PG4, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2f6cA (A:)
    slpplpgpdkkvpgmdikydvvivgsgpigctyarelvgagykvamfdigeidsglkiga
    hkkntveyqknidkfvnviqgqlmsvsvpvntlvvdtlsptswqastffvrngsnpeqdp
    lrnlsgqavtrvvggmsthwtcatprfdreqrpllvkddadaddaewdrlytkaesyfqt
    gtdqfkesirhnlvlnklaeeykgqrdfqqiplaatrrsptfvewssantvfdlqnrpnt
    dapeerfnlfpavacervvrnalnseieslhihdlisgdrfeikadvyvltagavhntql
    lvnsgfgqlgrpnptnppellpslgsyiteqslvfcqtvmstelidsvksdmtirgtpge
    ltysvtytpgastnkhpdwwnekvknhmmqhqedplpipfedpepqvttlfqpshpwhtq
    ihrdafsygavqqsidsrlivdwrffgrtepkeenklwfsdkitdaynmpqptfdfrfpa
    grtskeaedmmtdmcvmsakiggflpgslpqfmkpglvlhlggthrmgfdekednccvnt
    dsrvfgfknlflggcgniptayganptltamslaiksceyikqnftpspftseaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f6cA (A:)
    mdikydvvivgsgpigctyarelvgagykvamfdigeidsglkigahkkntveyqknidk
    fvnviqgqlmsvsvpvntlvvdtlsptswqastffvrngsnpeqdplrnlsgqavtrvvg
    gmsthwtcatprfdreqrpllvkddadaddaewdrlytkaesyfqtgtdqfkesirhnlv
    lnklaeeykgqrdfqqiplaatrrsptfvewssantvfdlqnrpntdapeerfnlfpava
    cervvrnalnseieslhihdlisgdrfeikadvyvltagavhntqllvnsgfgqlgrpnp
    tnppellpslgsyiteqslvfcqtvmstelidsvksdmtirgtpgeltysvtytpgastn
    khpdwwnekvknhmmqhqedplpipfedpepqvttlfqpshpwhtqihrdafsygavqqs
    idsrlivdwrffgrtepkeenklwfsdkitdaynmpqptfdfrfpagrtskeaedmmtdm
    cvmsakiggflpgslpqfmkpglvlhlggthrmgfdekednccvntdsrvfgfknlflgg
    cgniptayganptltamslaiksceyikqnftpspft