PDB entry 2f69

View 2f69 on RCSB PDB site
Description: Ternary complex of SET7/9 bound to AdoHcy and a TAF10 peptide
Class: transferase
Keywords: SET domain, protein lysine methyltransferase, enzyme-peptide-AdoHcy complex
Deposited on 2005-11-28, released 2006-01-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.15
AEROSPACI score: 0.76 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Histone-lysine N-methyltransferase, H3 lysine-4 specific SET7
    Species: Homo sapiens [TaxId:9606]
    Gene: SET7, KIAA1717
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2f69a1, d2f69a2
  • Chain 'B':
    Compound: TAF10 peptide, Acetyl-Ser-Lys-Ser-Mlz-Asp-Arg-Lys-Tyr-Thr-Leu
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 2F69
  • Heterogens: SAH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2f69A (A:)
    gamgykdnirhgvcwiyypdggslvgevnedgemtgekiayvypdertalygkfidgemi
    egklatlmsteegrphfelmpgnsvyhfdkstsscistnallpdpyeservyvaesliss
    ageglfskvavgpntvmsfyngvrithqevdsrdwalngntlsldeetvidvpepynhvs
    kycaslghkanhsftpnciydmfvhprfgpikcirtlraveadeeltvaygydhsppgks
    gpeapewyqvelkafqatqqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f69A (A:)
    hgvcwiyypdggslvgevnedgemtgekiayvypdertalygkfidgemiegklatlmst
    eegrphfelmpgnsvyhfdkstsscistnallpdpyeservyvaeslissageglfskva
    vgpntvmsfyngvrithqevdsrdwalngntlsldeetvidvpepynhvskycaslghka
    nhsftpnciydmfvhprfgpikcirtlraveadeeltvaygydhsppeapewyqvelkaf
    qatq
    

  • Chain 'B':
    No sequence available.