PDB entry 2f66

View 2f66 on RCSB PDB site
Description: Structure of the ESCRT-I endosomal trafficking complex
Class: transport protein
Keywords: Endosome, Trafficking complex, Vps23, Vps28, Vps37, Vacuolar Protein Sorting, ESCRT protein complexes, Endosomal Sorting Complex Required for Transport, ESCRT-I, ubiquitin, Tsg101
Deposited on 2005-11-28, released 2006-04-18
The last revision prior to the SCOP 1.73 freeze date was dated 2006-04-18, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.203
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: suppressor protein stp22 of temperature-sensitive alpha-factor receptor and arginine permease
    Species: Saccharomyces cerevisiae
    Gene: STP22, VPS23
    Database cross-references and differences (RAF-indexed):
    • Uniprot P25604 (1-64)
      • cloning artifact (0)
      • engineered (23)
    Domains in SCOP 1.73: d2f66a1
  • Chain 'B':
    Compound: vacuolar protein sorting-associated protein vps28
    Species: Saccharomyces cerevisiae
    Gene: VPS28, VPT28
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q02767 (5-115)
      • engineered (91)
    Domains in SCOP 1.73: d2f66b1
  • Chain 'C':
    Compound: protein srn2
    Species: Saccharomyces cerevisiae
    Gene: SRN2, VPS37
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2f66c1
  • Chain 'D':
    Compound: suppressor protein stp22 of temperature-sensitive alpha-factor receptor and arginine permease
    Species: Saccharomyces cerevisiae
    Gene: STP22, VPS23
    Database cross-references and differences (RAF-indexed):
    • Uniprot P25604 (1-64)
      • cloning artifact (0)
      • engineered (23)
    Domains in SCOP 1.73: d2f66d1
  • Chain 'E':
    Compound: vacuolar protein sorting-associated protein vps28
    Species: Saccharomyces cerevisiae
    Gene: VPS28, VPT28
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q02767 (5-115)
      • engineered (91)
    Domains in SCOP 1.73: d2f66e1
  • Chain 'F':
    Compound: protein srn2
    Species: Saccharomyces cerevisiae
    Gene: SRN2, VPS37
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2f66f1
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2f66A (A:)
    mtdglnqlynlvaqdyaltdtiealsrmlhrgtipldtfvkqgrelarqqflvrwhiqri
    tspls
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2f66B (B:)
    gamdisqlfhdevplfdnsitskdkevietlseiysivitldhvekaylkdsiddtqytn
    tvdkllkqfkvylnsqnkeeinkhfqsieafadtynitasnaitrlergipitaeh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f66B (B:)
    sqlfhdevplfdnsitskdkevietlseiysivitldhvekaylkdsiddtqytntvdkl
    lkqfkvylnsqnkeeinkhfqsieafadtynitasnaitrlergipitaeh
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2f66C (C:)
    aswqdyhsefskkygdialkkkleqntkkldeessqletttrsidsaddldqfiknyldi
    rtqyhlrreklatwdkqgnlky
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f66C (C:)
    skkygdialkkkleqntkkldeessqletttrsidsaddldqfiknyldirtqyhlrrek
    latwd
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2f66D (D:)
    mtdglnqlynlvaqdyaltdtiealsrmlhrgtipldtfvkqgrelarqqflvrwhiqri
    tspls
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2f66E (E:)
    gamdisqlfhdevplfdnsitskdkevietlseiysivitldhvekaylkdsiddtqytn
    tvdkllkqfkvylnsqnkeeinkhfqsieafadtynitasnaitrlergipitaeh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f66E (E:)
    sqlfhdevplfdnsitskdkevietlseiysivitldhvekaylkdsiddtqytntvdkl
    lkqfkvylnsqnkeeinkhfqsieafadtynitasnaitrlergipitaeh
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2f66F (F:)
    aswqdyhsefskkygdialkkkleqntkkldeessqletttrsidsaddldqfiknyldi
    rtqyhlrreklatwdkqgnlky
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f66F (F:)
    ygdialkkkleqntkkldeessqletttrsidsaddldqfiknyldirtqyhlrreklat
    wdk